prot_M-pyrifera_M_contig10.3.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig10.3.1 vs. uniprot
Match: A0A2G5BA18_COERN (Alpha/beta-hydrolase n=1 Tax=Coemansia reversa (strain ATCC 12441 / NRRL 1564) TaxID=763665 RepID=A0A2G5BA18_COERN) HSP 1 Score: 52.0 bits (123), Expect = 1.050e-6 Identity = 22/33 (66.67%), Postives = 25/33 (75.76%), Query Frame = 0 Query: 1 MHHGFCSARGNWSIPEQATRAGEAIDTFVKFFD 33 M HGFC ARG+WS PEQA RA +AI VKFF+ Sbjct: 204 MFHGFCGARGDWSNPEQARRANDAIKLLVKFFN 236 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig10.3.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig10.3.1 ID=prot_M-pyrifera_M_contig10.3.1|Name=mRNA_M-pyrifera_M_contig10.3.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=39bpback to top |