mRNA_M-pyrifera_M_contig101583.328.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig101583.328.1 vs. uniprot
Match: A0A368KZ52_9BACT (Type I-U CRISPR-associated protein Cas7 n=1 Tax=Blastopirellula cremea TaxID=1031537 RepID=A0A368KZ52_9BACT) HSP 1 Score: 55.1 bits (131), Expect = 2.200e-7 Identity = 28/53 (52.83%), Postives = 37/53 (69.81%), Query Frame = 1 Query: 1 KCDVVYCSDQRDPLNTTHDEALAFATAADEAFGVRKKRTVDFDKKKAANDVKK 159 +C VY S +R P +H++A+AFA A EAFGV + +TV FDKKKA D+KK Sbjct: 300 ECCEVYRSGERKPFKLSHEDAIAFAQLAAEAFGVGENQTVAFDKKKAKADMKK 352
BLAST of mRNA_M-pyrifera_M_contig101583.328.1 vs. uniprot
Match: A0A7X7F4T0_9BACT (Type I-U CRISPR-associated protein Cas7 n=1 Tax=Pirellulaceae bacterium TaxID=2699754 RepID=A0A7X7F4T0_9BACT) HSP 1 Score: 50.8 bits (120), Expect = 6.970e-6 Identity = 26/48 (54.17%), Postives = 32/48 (66.67%), Query Frame = 1 Query: 13 VYCSDQRDPLNTTHDEALAFATAADEAFGVRKKRTVDFDKKKAANDVK 156 VY + +R P TH+ AL FAT A + FGV K R V+FDKK+A DVK Sbjct: 281 VYPTGERKPATITHEAALEFATQAAKEFGVGKDREVEFDKKRAEQDVK 328 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig101583.328.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig101583.328.1 >prot_M-pyrifera_M_contig101583.328.1 ID=prot_M-pyrifera_M_contig101583.328.1|Name=mRNA_M-pyrifera_M_contig101583.328.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=56bp KCDVVYCSDQRDPLNTTHDEALAFATAADEAFGVRKKRTVDFDKKKAANDback to top mRNA from alignment at M-pyrifera_M_contig101583:266..433+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig101583.328.1 ID=mRNA_M-pyrifera_M_contig101583.328.1|Name=mRNA_M-pyrifera_M_contig101583.328.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=168bp|location=Sequence derived from alignment at M-pyrifera_M_contig101583:266..433+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig101583:266..433+ >mRNA_M-pyrifera_M_contig101583.328.1 ID=mRNA_M-pyrifera_M_contig101583.328.1|Name=mRNA_M-pyrifera_M_contig101583.328.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=336bp|location=Sequence derived from alignment at M-pyrifera_M_contig101583:266..433+ (Macrocystis pyrifera P11B4 male)back to top |