mRNA_M-pyrifera_M_contig101351.286.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig101351.286.1 vs. uniprot
Match: A0A517W8P8_9PLAN (Photosystem I assembly protein Ycf3 n=11 Tax=Gimesia TaxID=1649453 RepID=A0A517W8P8_9PLAN) HSP 1 Score: 79.3 bits (194), Expect = 1.670e-16 Identity = 38/38 (100.00%), Postives = 38/38 (100.00%), Query Frame = 1 Query: 1 GFEPPLNISNDDYIPSDDGAFFETVESAESVTNVRSAE 114 GFEPPLNISNDDYIPSDDGAFFETVESAESVTNVRSAE Sbjct: 293 GFEPPLNISNDDYIPSDDGAFFETVESAESVTNVRSAE 330
BLAST of mRNA_M-pyrifera_M_contig101351.286.1 vs. uniprot
Match: A0A517Q3B7_9PLAN (Photosystem I assembly protein Ycf3 n=2 Tax=Gimesia panareensis TaxID=2527978 RepID=A0A517Q3B7_9PLAN) HSP 1 Score: 70.9 bits (172), Expect = 2.130e-13 Identity = 34/38 (89.47%), Postives = 36/38 (94.74%), Query Frame = 1 Query: 1 GFEPPLNISNDDYIPSDDGAFFETVESAESVTNVRSAE 114 GFEPPLNISNDDYIPS + AFFETVESA+SVTNVRSAE Sbjct: 292 GFEPPLNISNDDYIPSGNDAFFETVESAQSVTNVRSAE 329
BLAST of mRNA_M-pyrifera_M_contig101351.286.1 vs. uniprot
Match: A0A517VBQ4_9PLAN (Photosystem I assembly protein Ycf3 n=1 Tax=Gimesia algae TaxID=2527971 RepID=A0A517VBQ4_9PLAN) HSP 1 Score: 63.9 bits (154), Expect = 7.190e-11 Identity = 29/38 (76.32%), Postives = 34/38 (89.47%), Query Frame = 1 Query: 1 GFEPPLNISNDDYIPSDDGAFFETVESAESVTNVRSAE 114 GFEPPL++SNDDYIPS D +F ETV+S+ESVTNVRS E Sbjct: 304 GFEPPLHVSNDDYIPSVDNSFLETVQSSESVTNVRSVE 341
BLAST of mRNA_M-pyrifera_M_contig101351.286.1 vs. uniprot
Match: A0A518I8V4_9PLAN (Photosystem I assembly protein Ycf3 n=2 Tax=Gimesia TaxID=1649453 RepID=A0A518I8V4_9PLAN) HSP 1 Score: 61.6 bits (148), Expect = 4.800e-10 Identity = 28/38 (73.68%), Postives = 32/38 (84.21%), Query Frame = 1 Query: 1 GFEPPLNISNDDYIPSDDGAFFETVESAESVTNVRSAE 114 GFEPPLN+SNDDYIPS+ FF TV+S +SVT VRSAE Sbjct: 299 GFEPPLNVSNDDYIPSESNDFFVTVQSTQSVTTVRSAE 336
BLAST of mRNA_M-pyrifera_M_contig101351.286.1 vs. uniprot
Match: A6CDG9_9PLAN (TPR repeat protein n=8 Tax=Planctomycetaceae TaxID=126 RepID=A6CDG9_9PLAN) HSP 1 Score: 61.2 bits (147), Expect = 5.680e-10 Identity = 28/38 (73.68%), Postives = 32/38 (84.21%), Query Frame = 1 Query: 1 GFEPPLNISNDDYIPSDDGAFFETVESAESVTNVRSAE 114 GFEPPL++SNDDYIPS D F +TV+S ESVTNVRS E Sbjct: 255 GFEPPLHVSNDDYIPSVDNTFLKTVQSLESVTNVRSVE 292
BLAST of mRNA_M-pyrifera_M_contig101351.286.1 vs. uniprot
Match: A0A517W0N5_9PLAN (Photosystem I assembly protein Ycf3 n=2 Tax=Gimesia aquarii TaxID=2527964 RepID=A0A517W0N5_9PLAN) HSP 1 Score: 60.5 bits (145), Expect = 1.220e-9 Identity = 26/38 (68.42%), Postives = 33/38 (86.84%), Query Frame = 1 Query: 1 GFEPPLNISNDDYIPSDDGAFFETVESAESVTNVRSAE 114 GFEPPL++SNDD+IPS+ FFETV+S ES+TNVR+ E Sbjct: 292 GFEPPLHVSNDDFIPSESNEFFETVQSTESMTNVRAEE 329
BLAST of mRNA_M-pyrifera_M_contig101351.286.1 vs. uniprot
Match: A0A2E2CBQ8_9PLAN (Uncharacterized protein n=3 Tax=Planctomycetaceae TaxID=126 RepID=A0A2E2CBQ8_9PLAN) HSP 1 Score: 60.5 bits (145), Expect = 1.250e-9 Identity = 27/38 (71.05%), Postives = 33/38 (86.84%), Query Frame = 1 Query: 1 GFEPPLNISNDDYIPSDDGAFFETVESAESVTNVRSAE 114 GFEPPL++SN+DYIPS D F +TV+S+ESVT VRSAE Sbjct: 305 GFEPPLHVSNEDYIPSADNTFLQTVQSSESVTTVRSAE 342 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig101351.286.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 7
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig101351.286.1 >prot_M-pyrifera_M_contig101351.286.1 ID=prot_M-pyrifera_M_contig101351.286.1|Name=mRNA_M-pyrifera_M_contig101351.286.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=39bp GFEPPLNISNDDYIPSDDGAFFETVESAESVTNVRSAE*back to top mRNA from alignment at M-pyrifera_M_contig101351:2..118+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig101351.286.1 ID=mRNA_M-pyrifera_M_contig101351.286.1|Name=mRNA_M-pyrifera_M_contig101351.286.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=117bp|location=Sequence derived from alignment at M-pyrifera_M_contig101351:2..118+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig101351:2..118+ >mRNA_M-pyrifera_M_contig101351.286.1 ID=mRNA_M-pyrifera_M_contig101351.286.1|Name=mRNA_M-pyrifera_M_contig101351.286.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=234bp|location=Sequence derived from alignment at M-pyrifera_M_contig101351:2..118+ (Macrocystis pyrifera P11B4 male)back to top |