mRNA_M-pyrifera_M_contig101239.260.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig101239.260.1 vs. uniprot
Match: A0A5F9DDW4_RABIT (PKHD1 like 1 n=1 Tax=Oryctolagus cuniculus TaxID=9986 RepID=A0A5F9DDW4_RABIT) HSP 1 Score: 53.1 bits (126), Expect = 2.000e-6 Identity = 26/65 (40.00%), Postives = 37/65 (56.92%), Query Frame = 1 Query: 1 IVFAYQVVIDSVYPQYWSAGGGDRVMIVGSGFLDDASREEVLVDGKECRIDSVHSNHTHLFCTSP 195 +VF Y + I ++P S GGG +M+ G+GF + VLV G EC +D + SN+T L C P Sbjct: 1957 VVFEYPLDIQDIHPHQGSFGGGQTLMMTGTGF--NPQNSIVLVCGSECAVDRLSSNYTTLLCKIP 2019
BLAST of mRNA_M-pyrifera_M_contig101239.260.1 vs. uniprot
Match: G1TUG6_RABIT (PKHD1 like 1 n=2 Tax=Oryctolagus cuniculus TaxID=9986 RepID=G1TUG6_RABIT) HSP 1 Score: 53.1 bits (126), Expect = 2.000e-6 Identity = 26/65 (40.00%), Postives = 37/65 (56.92%), Query Frame = 1 Query: 1 IVFAYQVVIDSVYPQYWSAGGGDRVMIVGSGFLDDASREEVLVDGKECRIDSVHSNHTHLFCTSP 195 +VF Y + I ++P S GGG +M+ G+GF + VLV G EC +D + SN+T L C P Sbjct: 1968 VVFEYPLDIQDIHPHQGSFGGGQTLMMTGTGF--NPQNSIVLVCGSECAVDRLSSNYTTLLCKIP 2030 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig101239.260.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig101239.260.1 >prot_M-pyrifera_M_contig101239.260.1 ID=prot_M-pyrifera_M_contig101239.260.1|Name=mRNA_M-pyrifera_M_contig101239.260.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=70bp IVFAYQVVIDSVYPQYWSAGGGDRVMIVGSGFLDDASREEVLVDGKECRIback to top mRNA from alignment at M-pyrifera_M_contig101239:339..548- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig101239.260.1 ID=mRNA_M-pyrifera_M_contig101239.260.1|Name=mRNA_M-pyrifera_M_contig101239.260.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=210bp|location=Sequence derived from alignment at M-pyrifera_M_contig101239:339..548- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig101239:339..548- >mRNA_M-pyrifera_M_contig101239.260.1 ID=mRNA_M-pyrifera_M_contig101239.260.1|Name=mRNA_M-pyrifera_M_contig101239.260.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=420bp|location=Sequence derived from alignment at M-pyrifera_M_contig101239:339..548- (Macrocystis pyrifera P11B4 male)back to top |