prot_M-pyrifera_M_contig9962.22902.1 (polypeptide) Macrocystis pyrifera P11B4 male

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig9962.22902.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
HLKIGTALRTLAQEQDVLIVGSGQATHNMASYPGYARGEAAPREAQFMDWLKDTATNASVSPEERRRRLLEWKKAPYARLAHPREEHLLPMHVVSGCTDFAPGKLIFDDFVMGAMSLA102030405060708090100110Expect = 5.22e-43 / Id = 61.67Expect = 2.36e-27 / Id = 44.92Expect = 5.48e-26 / Id = 45.76Expect = 1.67e-25 / Id = 44.92Expect = 2.09e-25 / Id = 46.61Expect = 3.25e-25 / Id = 48.70Expect = 3.60e-25 / Id = 49.15Expect = 8.66e-25 / Id = 49.59Expect = 1.41e-24 / Id = 46.61Expect = 1.66e-24 / Id = 43.22SequenceD8LRX5_ECTSIA0A2T6E2T7_9GAMMA0A2N2LZT9_9CHLRA0A354Z8M8_9SPIOA0A3D4NFJ2_9CHLRUPI001C58C7A1A0A5K7YQZ9_9DELTA0A836CEX8_9STRAA0A496XGL0_9GAMMA0A354A4G4_9BACT
Match NameE-valueIdentityDescription
D8LRX5_ECTSI5.220e-4361.67LigB domain-containing protein n=2 Tax=Ectocarpus ... [more]
A0A2T6E2T7_9GAMM2.360e-2744.92Dioxygenase n=1 Tax=Saccharospirillum sp. MSK14-1 ... [more]
A0A2N2LZT9_9CHLR5.480e-2645.76Dioxygenase n=1 Tax=Chloroflexi bacterium HGW-Chlo... [more]
A0A354Z8M8_9SPIO1.670e-2544.92Dioxygenase n=1 Tax=Spirochaetaceae bacterium TaxI... [more]
A0A3D4NFJ2_9CHLR2.090e-2546.61Dioxygenase n=2 Tax=Bacteria TaxID=2 RepID=A0A3D4N... [more]
UPI001C58C7A13.250e-2548.70dioxygenase n=1 Tax=Zhongshania sp. CAU 1632 TaxID... [more]
A0A5K7YQZ9_9DELT3.600e-2549.15Dioxygenase n=1 Tax=Desulfosarcina alkanivorans Ta... [more]
A0A836CEX8_9STRA8.660e-2549.59Catalytic LigB subunit of aromatic ring-opening di... [more]
A0A496XGL0_9GAMM1.410e-2446.61Dioxygenase n=1 Tax=Gammaproteobacteria bacterium ... [more]
A0A354A4G4_9BACT1.660e-2443.22Dioxygenase n=1 Tax=Nitrospiraceae bacterium TaxID... [more]

Pages

back to top