prot_M-pyrifera_M_contig99387.22864.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig99387.22864.1 vs. uniprot
Match: A0A358A2X2_9ACTN (Uncharacterized protein (Fragment) n=1 Tax=Acidimicrobiaceae bacterium TaxID=2024894 RepID=A0A358A2X2_9ACTN) HSP 1 Score: 81.6 bits (200), Expect = 5.780e-19 Identity = 41/70 (58.57%), Postives = 47/70 (67.14%), Query Frame = 0 Query: 1 LTVALDVTPLAGAPTGIHQVTKGLLRSLRHRDDVDVRGWMLSARGRPPDIDIPVRHSRIPAAVALRGWAR 70 L V +D+TPL G PTGIHQ T+ L +L RDDV V GW+LSARG P P+R S IPAA A R WAR Sbjct: 2 LRVGIDITPLVGPPTGIHQHTRHLTDALLSRDDVTVSGWLLSARGSKPRFAGPIRRSPIPAAPAARLWAR 71
BLAST of mRNA_M-pyrifera_M_contig99387.22864.1 vs. uniprot
Match: A0A2E0SYE8_9ACTN (Glycos_transf_1 domain-containing protein n=2 Tax=Acidimicrobiaceae bacterium TaxID=2024894 RepID=A0A2E0SYE8_9ACTN) HSP 1 Score: 82.8 bits (203), Expect = 3.950e-17 Identity = 41/70 (58.57%), Postives = 48/70 (68.57%), Query Frame = 0 Query: 1 LTVALDVTPLAGAPTGIHQVTKGLLRSLRHRDDVDVRGWMLSARGRPPDIDIPVRHSRIPAAVALRGWAR 70 L V +D+TPL G PTGIHQ T+ L +L RDDV V GW+LSARGR P P+R S IPA+ A R WAR Sbjct: 3 LRVGIDITPLVGPPTGIHQHTRHLTDALLSRDDVTVSGWLLSARGRKPRFAGPIRRSPIPASPAARLWAR 72
BLAST of mRNA_M-pyrifera_M_contig99387.22864.1 vs. uniprot
Match: A0A2E7NGS8_9BACT (Glycos_transf_1 domain-containing protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2E7NGS8_9BACT) HSP 1 Score: 62.0 bits (149), Expect = 1.370e-9 Identity = 34/74 (45.95%), Postives = 42/74 (56.76%), Query Frame = 0 Query: 1 LTVALDVTPLAGAPTGIHQVTKGLLRSLRHRDDVDVRGWMLSARGRPPDIDIP----VRHSRIPAAVALRGWAR 70 L VALDVTPLAG PTGI + G+L +L + + GWMLS R R +P V H +PA + GWAR Sbjct: 5 LRVALDVTPLAGEPTGIARAVDGVLHALWTDQSLAISGWMLSGRRRARPDGVPAGMSVHHCPVPARLLHPGWAR 78
BLAST of mRNA_M-pyrifera_M_contig99387.22864.1 vs. uniprot
Match: A0A381YZU4_9ZZZZ (Glycos_transf_1 domain-containing protein n=1 Tax=marine metagenome TaxID=408172 RepID=A0A381YZU4_9ZZZZ) HSP 1 Score: 60.5 bits (145), Expect = 4.830e-9 Identity = 34/74 (45.95%), Postives = 43/74 (58.11%), Query Frame = 0 Query: 1 LTVALDVTPLAGAPTGIHQVTKGLLRSLRHRDDVDVRGWMLSARGR--PPDID--IPVRHSRIPAAVALRGWAR 70 L VALDVTPLAG PTGI + G++ +L + V GWMLS R R P + +PV H +PA + WAR Sbjct: 5 LRVALDVTPLAGEPTGIARAINGVIHALCADPSLAVSGWMLSGRRRAHPSGVPSGVPVHHCPVPARLLHPSWAR 78 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig99387.22864.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig99387.22864.1 ID=prot_M-pyrifera_M_contig99387.22864.1|Name=mRNA_M-pyrifera_M_contig99387.22864.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=70bpback to top |