prot_M-pyrifera_M_contig99302.22847.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig99302.22847.1 vs. uniprot
Match: A0A656TCA9_9ACTN (Uncharacterized protein (Fragment) n=1 Tax=Streptomyces sp. NRRL S-444 TaxID=1609134 RepID=A0A656TCA9_9ACTN) HSP 1 Score: 50.1 bits (118), Expect = 6.960e-6 Identity = 24/41 (58.54%), Postives = 29/41 (70.73%), Query Frame = 0 Query: 1 GHRGRVHAVSFSADGLLVATGSGDGTLRVWDRRTGLARGCL 41 GH G V +VSFSADGL +ATGS D T+R+WD + G R L Sbjct: 3 GHGGVVRSVSFSADGLTLATGSDDRTVRLWDAKNGALRTVL 43
BLAST of mRNA_M-pyrifera_M_contig99302.22847.1 vs. uniprot
Match: A0A8H4RMU1_9HELO (Protein kinase domain-containing protein n=1 Tax=Cudoniella acicularis TaxID=354080 RepID=A0A8H4RMU1_9HELO) HSP 1 Score: 53.1 bits (126), Expect = 1.080e-5 Identity = 25/43 (58.14%), Postives = 32/43 (74.42%), Query Frame = 0 Query: 1 GHRGRVHAVSFSADGLLVATGSGDGTLRVWDRRTGLARGCLRG 43 GH G V AV+FS DG L+A+GS D T+R+WD TG A+G L+G Sbjct: 470 GHSGGVGAVAFSPDGKLIASGSRDETIRLWDAATGEAQGTLKG 512
BLAST of mRNA_M-pyrifera_M_contig99302.22847.1 vs. uniprot
Match: A0A7C9MTY6_9ACTN (Uncharacterized protein n=2 Tax=Herbidospora solisilvae TaxID=2696284 RepID=A0A7C9MTY6_9ACTN) HSP 1 Score: 52.8 bits (125), Expect = 1.370e-5 Identity = 22/35 (62.86%), Postives = 28/35 (80.00%), Query Frame = 0 Query: 1 GHRGRVHAVSFSADGLLVATGSGDGTLRVWDRRTG 35 GH GRV +V+FS DG +A+G GDGT+R+WD RTG Sbjct: 169 GHTGRVSSVAFSPDGTRLASGGGDGTVRIWDARTG 203
BLAST of mRNA_M-pyrifera_M_contig99302.22847.1 vs. uniprot
Match: A0A5N5WFR4_9EURO (WD40-repeat-containing domain protein (Fragment) n=1 Tax=Aspergillus leporis TaxID=41062 RepID=A0A5N5WFR4_9EURO) HSP 1 Score: 50.4 bits (119), Expect = 1.550e-5 Identity = 22/41 (53.66%), Postives = 30/41 (73.17%), Query Frame = 0 Query: 1 GHRGRVHAVSFSADGLLVATGSGDGTLRVWDRRTGLARGCL 41 GH RV++V+FS DGL +A+GS DGT+++WD TG R L Sbjct: 8 GHSSRVYSVAFSLDGLTLASGSNDGTIKLWDTTTGTHRQTL 48
BLAST of mRNA_M-pyrifera_M_contig99302.22847.1 vs. uniprot
Match: J3P4T9_GAET3 (NACHT_N domain-containing protein n=1 Tax=Gaeumannomyces tritici (strain R3-111a-1) TaxID=644352 RepID=J3P4T9_GAET3) HSP 1 Score: 52.4 bits (124), Expect = 2.180e-5 Identity = 27/41 (65.85%), Postives = 31/41 (75.61%), Query Frame = 0 Query: 1 GHRGRVHAVSFSADGLLVATGSGDGTLRVWDRRTG--LARG 39 GHRG VH VS SADG LVA+ S DGT+ VWD +TG L+RG Sbjct: 1459 GHRGPVHCVSMSADGSLVASASTDGTICVWDGKTGENLSRG 1499
BLAST of mRNA_M-pyrifera_M_contig99302.22847.1 vs. uniprot
Match: UPI001BE55662 (trypsin-like peptidase domain-containing protein n=1 Tax=Streptomyces sp. ISL-66 TaxID=2819186 RepID=UPI001BE55662) HSP 1 Score: 50.8 bits (120), Expect = 7.450e-5 Identity = 24/42 (57.14%), Postives = 27/42 (64.29%), Query Frame = 0 Query: 1 GHRGRVHAVSFSADGLLVATGSGDGTLRVWDRRTGLARGCLR 42 GH G V V+FS DG +ATGS DGT R+WD TG R LR Sbjct: 763 GHTGSVDGVAFSPDGGTLATGSADGTARLWDTATGTTRATLR 804
BLAST of mRNA_M-pyrifera_M_contig99302.22847.1 vs. uniprot
Match: M2QWJ9_CERS8 (NACHT domain-containing protein n=1 Tax=Ceriporiopsis subvermispora (strain B) TaxID=914234 RepID=M2QWJ9_CERS8) HSP 1 Score: 50.8 bits (120), Expect = 7.480e-5 Identity = 21/35 (60.00%), Postives = 28/35 (80.00%), Query Frame = 0 Query: 1 GHRGRVHAVSFSADGLLVATGSGDGTLRVWDRRTG 35 GH G +++V+FS DG VA+GS DGT+R+WD RTG Sbjct: 760 GHAGAIYSVAFSPDGTRVASGSHDGTVRIWDTRTG 794
BLAST of mRNA_M-pyrifera_M_contig99302.22847.1 vs. uniprot
Match: A0A1L9Q4A1_ASPVE (NACHT domain-containing protein n=1 Tax=Aspergillus versicolor CBS 583.65 TaxID=1036611 RepID=A0A1L9Q4A1_ASPVE) HSP 1 Score: 50.8 bits (120), Expect = 7.480e-5 Identity = 22/35 (62.86%), Postives = 28/35 (80.00%), Query Frame = 0 Query: 1 GHRGRVHAVSFSADGLLVATGSGDGTLRVWDRRTG 35 GH G V AV+FS DGL++A+GS DGT+R+WD TG Sbjct: 955 GHAGWVSAVAFSPDGLIIASGSRDGTIRLWDAATG 989
BLAST of mRNA_M-pyrifera_M_contig99302.22847.1 vs. uniprot
Match: UPI001B85FC15 (WD40-repeat-containing domain protein n=1 Tax=Suillus discolor TaxID=1912936 RepID=UPI001B85FC15) HSP 1 Score: 49.7 bits (117), Expect = 8.970e-5 Identity = 24/41 (58.54%), Postives = 29/41 (70.73%), Query Frame = 0 Query: 1 GHRGRVHAVSFSADGLLVATGSGDGTLRVWDRRTGLARGCL 41 GH RV +V+ SADG L+A+GS D T+RVWD TG A G L Sbjct: 16 GHTNRVWSVAISADGTLIASGSSDKTVRVWDADTGNALGTL 56 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig99302.22847.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 9
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig99302.22847.1 ID=prot_M-pyrifera_M_contig99302.22847.1|Name=mRNA_M-pyrifera_M_contig99302.22847.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=118bpback to top |