prot_M-pyrifera_M_contig99296.22845.1 (polypeptide) Macrocystis pyrifera P11B4 male

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig99296.22845.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
KVPVWVTGSESHFSLLFALDGSANEADPATAVRRAFDARDPTGGGFVPKDDLGAVLAALHLPLADHPIQLQVWKKSSFDAGMDVVTWGAFWEKVRPQLIKHSDEPGSE102030405060708090100Expect = 7.88e-14 / Id = 36.79Expect = 1.31e-13 / Id = 38.38Expect = 1.42e-12 / Id = 37.39Expect = 3.58e-10 / Id = 43.43Expect = 3.79e-10 / Id = 43.43Expect = 3.81e-10 / Id = 43.43Expect = 3.87e-10 / Id = 43.43Expect = 9.51e-10 / Id = 37.37Expect = 1.30e-9 / Id = 36.36Expect = 1.76e-9 / Id = 36.36SequenceA0A2R5GMJ3_9STRAA0A813AC68_9DINOI2CPJ8_NANGCA0A6A4YV63_9STRAA0A397BDA2_9STRAA0A3R6XDD3_9STRAA0A397BKK2_9STRAA0A2K1KIQ1_PHYPAA0A200QFB7_9MAGNA0A4P1RKA6_LUPAN
Match NameE-valueIdentityDescription
A0A2R5GMJ3_9STRA7.880e-1436.79Ubiquitinyl hydrolase 1 n=1 Tax=Hondaea fermentalg... [more]
A0A813AC68_9DINO1.310e-1338.38Ubiquitinyl hydrolase 1 (Fragment) n=1 Tax=Symbiod... [more]
I2CPJ8_NANGC1.420e-1237.39Ubiquitinyl hydrolase 1 (Fragment) n=1 Tax=Nannoch... [more]
A0A6A4YV63_9STRA3.580e-1043.43Ubiquitinyl hydrolase 1 (Fragment) n=3 Tax=Aphanom... [more]
A0A397BDA2_9STRA3.790e-1043.43Ubiquitinyl hydrolase 1 n=7 Tax=Aphanomyces astaci... [more]
A0A3R6XDD3_9STRA3.810e-1043.43Ubiquitinyl hydrolase 1 (Fragment) n=1 Tax=Aphanom... [more]
A0A397BKK2_9STRA3.870e-1043.43Ubiquitinyl hydrolase 1 n=2 Tax=Aphanomyces astaci... [more]
A0A2K1KIQ1_PHYPA9.510e-1037.37Ubiquitinyl hydrolase 1 n=2 Tax=Physcomitrium pate... [more]
A0A200QFB7_9MAGN1.300e-936.36Ubiquitinyl hydrolase 1 n=1 Tax=Macleaya cordata T... [more]
A0A4P1RKA6_LUPAN1.760e-936.36Ubiquitinyl hydrolase 1 n=2 Tax=Lupinus TaxID=3869... [more]

Pages

back to top