prot_M-pyrifera_M_contig99078.22794.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig99078.22794.1 vs. uniprot
Match: A0A7S2DJI8_9EUKA (Hypothetical protein n=1 Tax=Haptolina brevifila TaxID=156173 RepID=A0A7S2DJI8_9EUKA) HSP 1 Score: 49.7 bits (117), Expect = 9.120e-5 Identity = 36/87 (41.38%), Postives = 42/87 (48.28%), Query Frame = 0 Query: 11 RKFHSAMQFRG--QVLVYGGVGANGEVLNDLAVFDAASNQWLDPSARLRRLGVTPPARFAMAFFTVSESQLALYGGAEASGSANRDL 95 RK HS M F G Q +YGG GA+ E+L+DL VFD QW P A L P R A V+E L +YGG G L Sbjct: 89 RKNHS-MTFGGTSQFWIYGGRGADDELLSDLFVFDMQEEQWSQPQA----LSTPPEPRENHAACFVAERYLVIYGGTNDEGEVLNSL 170 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig99078.22794.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig99078.22794.1 ID=prot_M-pyrifera_M_contig99078.22794.1|Name=mRNA_M-pyrifera_M_contig99078.22794.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=98bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|