prot_M-pyrifera_M_contig99072.22791.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig99072.22791.1 vs. uniprot
Match: F0ZB33_DICPU (H15 domain-containing protein n=1 Tax=Dictyostelium purpureum TaxID=5786 RepID=F0ZB33_DICPU) HSP 1 Score: 50.8 bits (120), Expect = 3.770e-5 Identity = 35/91 (38.46%), Postives = 53/91 (58.24%), Query Frame = 0 Query: 9 PAHPPFQTMALAAVAGLKSRKPVSAHAVRKYVLAEYTVQEG-TAARHLRVALAKLVEEGLLARVAASFKLTAAGRAALAKKG----RKPAA 94 P HP +Q M A+A LK R S A+ KY+ Y V + R LR+AL +L+++G+L ++ AS+KL+ G+ A +G +KPAA Sbjct: 19 PNHPTYQVMISHAIAALKERFGSSQPAIIKYIENNYNVGDSENFKRQLRLALKRLLKDGVLVQIKASYKLSEEGKKAHKSEGGAATKKPAA 109
BLAST of mRNA_M-pyrifera_M_contig99072.22791.1 vs. uniprot
Match: A0A6A0GQM3_HYAAZ (histone H1-delta-like n=1 Tax=Hyalella azteca TaxID=294128 RepID=A0A6A0GQM3_HYAAZ) HSP 1 Score: 50.1 bits (118), Expect = 8.860e-5 Identity = 33/83 (39.76%), Postives = 45/83 (54.22%), Query Frame = 0 Query: 11 HPPFQTMALAAVAGLKSRKPVSAHAVRKYVLAEYTVQEGTAARHLRVALAKLVEEGLLARVAAS-----FKLTAAGRAALAKK 88 HP + M AAVA LK RK SA A++KY+ A Y V+E + ++R AL + V G L +V S FKL + + KK Sbjct: 33 HPKYSEMVTAAVAALKERKGSSARAIKKYIAANYKVEEKSIGTYVRSALKRGVSSGQLTQVKGSGANGSFKLAESAKPKKEKK 115 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig99072.22791.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig99072.22791.1 ID=prot_M-pyrifera_M_contig99072.22791.1|Name=mRNA_M-pyrifera_M_contig99072.22791.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=127bpback to top |