prot_M-pyrifera_M_contig99037.22780.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig99037.22780.1 vs. uniprot
Match: D8LTR5_ECTSI (Arf-GAP domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LTR5_ECTSI) HSP 1 Score: 85.5 bits (210), Expect = 3.220e-18 Identity = 35/45 (77.78%), Postives = 43/45 (95.56%), Query Frame = 0 Query: 2 QVRSRWA-RADGSPSWSEKLMLCWDGSMPLNIDMYGGKEHIGQVR 45 +VRS+W+ R+DGSPSWSEKLMLCWDG+MPLNID+YGGK+HIGQ + Sbjct: 344 EVRSKWSKRSDGSPSWSEKLMLCWDGNMPLNIDIYGGKDHIGQAQ 388
BLAST of mRNA_M-pyrifera_M_contig99037.22780.1 vs. uniprot
Match: A0A6H5L6N3_9PHAE (Arf-GAP domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L6N3_9PHAE) HSP 1 Score: 84.3 bits (207), Expect = 8.200e-18 Identity = 34/45 (75.56%), Postives = 43/45 (95.56%), Query Frame = 0 Query: 2 QVRSRWAR-ADGSPSWSEKLMLCWDGSMPLNIDMYGGKEHIGQVR 45 +VRS+W++ +DGSPSWSEKLMLCWDG+MPLNID+YGGK+HIGQ + Sbjct: 374 EVRSKWSKKSDGSPSWSEKLMLCWDGNMPLNIDVYGGKDHIGQAQ 418 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig99037.22780.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig99037.22780.1 ID=prot_M-pyrifera_M_contig99037.22780.1|Name=mRNA_M-pyrifera_M_contig99037.22780.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=49bpback to top |