prot_M-pyrifera_M_contig97109.22366.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig97109.22366.1 vs. uniprot
Match: X6NF01_RETFI (Uncharacterized protein (Fragment) n=1 Tax=Reticulomyxa filosa TaxID=46433 RepID=X6NF01_RETFI) HSP 1 Score: 57.0 bits (136), Expect = 5.720e-8 Identity = 27/61 (44.26%), Postives = 37/61 (60.66%), Query Frame = 0 Query: 1 LKQLWNADVVIGLHGAGLSYFSFLPPGALLVELRTRYFKPEPLFANLARHLDARYALVDVR 61 +KQ + +DVVIGLHGAGL+ + PG +L+EL+ Y FAN+A + Y DVR Sbjct: 176 MKQFYASDVVIGLHGAGLTNILYTKPGTILIELKVPYGYAWGSFANIASQMGLAYYSADVR 236
BLAST of mRNA_M-pyrifera_M_contig97109.22366.1 vs. uniprot
Match: A0A813DF47_POLGL (Hypothetical protein (Fragment) n=1 Tax=Polarella glacialis TaxID=89957 RepID=A0A813DF47_POLGL) HSP 1 Score: 50.4 bits (119), Expect = 1.190e-5 Identity = 25/48 (52.08%), Postives = 32/48 (66.67%), Query Frame = 0 Query: 1 LKQLWNADVVIGLHGAGLSYFSFLPPGALLVELRTRYFKPEPLFANLA 48 ++ L +ADV+IGLHGAGL+ + P ALLVELR Y LF N+A Sbjct: 211 VQSLLSADVLIGLHGAGLANALYARPDALLVELRGSYAADNRLFVNVA 258
BLAST of mRNA_M-pyrifera_M_contig97109.22366.1 vs. uniprot
Match: A0A813H4M0_POLGL (Hypothetical protein n=1 Tax=Polarella glacialis TaxID=89957 RepID=A0A813H4M0_POLGL) HSP 1 Score: 50.4 bits (119), Expect = 1.210e-5 Identity = 25/48 (52.08%), Postives = 32/48 (66.67%), Query Frame = 0 Query: 1 LKQLWNADVVIGLHGAGLSYFSFLPPGALLVELRTRYFKPEPLFANLA 48 ++ L +ADV+IGLHGAGL+ + P ALLVELR Y LF N+A Sbjct: 181 VQSLLSADVLIGLHGAGLANALYARPDALLVELRGSYAADNRLFVNVA 228
BLAST of mRNA_M-pyrifera_M_contig97109.22366.1 vs. uniprot
Match: A0A0D9NHW2_METAN (GH18 domain-containing protein n=1 Tax=Metarhizium anisopliae BRIP 53293 TaxID=1291518 RepID=A0A0D9NHW2_METAN) HSP 1 Score: 48.1 bits (113), Expect = 7.920e-5 Identity = 24/55 (43.64%), Postives = 36/55 (65.45%), Query Frame = 0 Query: 1 LKQLWNADVVIGLHGAGLSYFSFLPPGALLVELRTRYFKPEPLFANLARHLDARY 55 LK + D++IG+HGAGL++ FLPPG+ ++E+ F F NLA+ LD +Y Sbjct: 375 LKIVCETDLLIGVHGAGLTHTMFLPPGSAVIEILPGNFAHMG-FRNLAQILDHKY 428
BLAST of mRNA_M-pyrifera_M_contig97109.22366.1 vs. uniprot
Match: A0A388L247_CHABU (Reverse transcriptase domain-containing protein n=1 Tax=Chara braunii TaxID=69332 RepID=A0A388L247_CHABU) HSP 1 Score: 48.1 bits (113), Expect = 7.940e-5 Identity = 23/61 (37.70%), Postives = 35/61 (57.38%), Query Frame = 0 Query: 1 LKQLWNADVVIGLHGAGLSYFSFLPPGALLVELRTRYFKPEPLFANLARHLDARYALVDVR 61 ++ + +A +VIG+HGA LSY + P + L+EL ++ FA AR+ RY V VR Sbjct: 779 IRVIRDASIVIGVHGASLSYTLLMDPRSTLIELMPPEYRGRTHFAMFARYAGVRYVRVPVR 839 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig97109.22366.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 5
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig97109.22366.1 ID=prot_M-pyrifera_M_contig97109.22366.1|Name=mRNA_M-pyrifera_M_contig97109.22366.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=61bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|