mRNA_M-pyrifera_M_contig90423.20962.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig90423.20962.1 vs. uniprot
Match: UPI00193A88B7 (YegP family protein n=2 Tax=Flavobacteriaceae TaxID=49546 RepID=UPI00193A88B7) HSP 1 Score: 56.2 bits (134), Expect = 7.760e-9 Identity = 30/49 (61.22%), Postives = 36/49 (73.47%), Query Frame = 1 Query: 7 MSYPRFEIKRSTSVTQPFYFVLKAVNTETILTSETYTSKQGCENGITSV 153 M P+FEIK ST+ FYF LKA N E ILTS+ YTSKQGC++G+ SV Sbjct: 1 MGQPKFEIKNSTN--DKFYFNLKAGNGEPILTSQMYTSKQGCKSGVNSV 47
BLAST of mRNA_M-pyrifera_M_contig90423.20962.1 vs. uniprot
Match: A0A1J6XEK5_9MICO (DUF1508 domain-containing protein n=1 Tax=Microbacterium sp. AR7-10 TaxID=1891970 RepID=A0A1J6XEK5_9MICO) HSP 1 Score: 54.7 bits (130), Expect = 9.410e-9 Identity = 26/43 (60.47%), Postives = 35/43 (81.40%), Query Frame = 1 Query: 25 EIKRSTSVTQPFYFVLKAVNTETILTSETYTSKQGCENGITSV 153 ++KRSTS +QPFYF + A N +T++TSETYTSKQG NG+ S+ Sbjct: 5 KLKRSTSASQPFYFTVVAGNGQTLVTSETYTSKQGAVNGMESL 47
BLAST of mRNA_M-pyrifera_M_contig90423.20962.1 vs. uniprot
Match: UPI001B3A7015 (DUF1508 domain-containing protein n=1 Tax=Aquimarina sp. MMG016 TaxID=2822690 RepID=UPI001B3A7015) HSP 1 Score: 52.8 bits (125), Expect = 5.320e-8 Identity = 28/49 (57.14%), Postives = 35/49 (71.43%), Query Frame = 1 Query: 7 MSYPRFEIKRSTSVTQPFYFVLKAVNTETILTSETYTSKQGCENGITSV 153 M+ P+FE+KRS++ +YF L A N + I TSE YTSKQ CENGI SV Sbjct: 1 MANPKFELKRSSN--DQYYFTLHAGNGKVIATSEMYTSKQACENGIDSV 47
BLAST of mRNA_M-pyrifera_M_contig90423.20962.1 vs. uniprot
Match: A6LT43_CLOB8 (DUF1508 domain-containing protein n=2 Tax=Clostridium beijerinckii TaxID=1520 RepID=A6LT43_CLOB8) HSP 1 Score: 52.8 bits (125), Expect = 6.560e-8 Identity = 28/51 (54.90%), Postives = 36/51 (70.59%), Query Frame = 1 Query: 1 EIMSYPRFEIKRSTSVTQPFYFVLKAVNTETILTSETYTSKQGCENGITSV 153 E++ RFEIK+S++ +YFVLKA N + IL SETYTSKQ C N I S+ Sbjct: 8 EVLEMARFEIKKSSN--DQYYFVLKANNGQVILQSETYTSKQNCNNCIKSI 56
BLAST of mRNA_M-pyrifera_M_contig90423.20962.1 vs. uniprot
Match: A0A5B1BEN8_9FLAO (DUF1508 domain-containing protein n=1 Tax=Aquimarina sp. RZ0 TaxID=2607730 RepID=A0A5B1BEN8_9FLAO) HSP 1 Score: 53.5 bits (127), Expect = 8.990e-8 Identity = 28/49 (57.14%), Postives = 37/49 (75.51%), Query Frame = 1 Query: 7 MSYPRFEIKRSTSVTQPFYFVLKAVNTETILTSETYTSKQGCENGITSV 153 MS P+F+IK S++ F+F L A+N + ILTSE YT+KQGC+ GITSV Sbjct: 1 MSNPKFQIKESSN--DQFFFNLHALNGQVILTSELYTTKQGCKGGITSV 47
BLAST of mRNA_M-pyrifera_M_contig90423.20962.1 vs. uniprot
Match: UPI001E585B0A (YegP family protein n=1 Tax=Fictibacillus sp. 5RED26 TaxID=2745876 RepID=UPI001E585B0A) HSP 1 Score: 52.8 bits (125), Expect = 1.620e-7 Identity = 28/45 (62.22%), Postives = 34/45 (75.56%), Query Frame = 1 Query: 19 RFEIKRSTSVTQPFYFVLKAVNTETILTSETYTSKQGCENGITSV 153 RFEIKRS + ++FV KAVN ETI+TSE YT+KQ C NG+ SV Sbjct: 4 RFEIKRSLNY--QYFFVFKAVNGETIITSEMYTTKQNCLNGVDSV 46
BLAST of mRNA_M-pyrifera_M_contig90423.20962.1 vs. uniprot
Match: UPI000716F274 (YegP family protein n=1 Tax=Solibacillus cecembensis TaxID=459347 RepID=UPI000716F274) HSP 1 Score: 50.8 bits (120), Expect = 3.530e-7 Identity = 28/49 (57.14%), Postives = 34/49 (69.39%), Query Frame = 1 Query: 7 MSYPRFEIKRSTSVTQPFYFVLKAVNTETILTSETYTSKQGCENGITSV 153 +S PRF I +S FYFVLKA N + I SETYT+KQ C+NGI+SV Sbjct: 7 ISKPRFVISKSKD--GQFYFVLKAPNGQVIAQSETYTTKQSCQNGISSV 53
BLAST of mRNA_M-pyrifera_M_contig90423.20962.1 vs. uniprot
Match: UPI0006BA2628 (YegP family protein n=1 Tax=Citrobacter sp. CtB7.12 TaxID=1696093 RepID=UPI0006BA2628) HSP 1 Score: 49.3 bits (116), Expect = 1.310e-6 Identity = 26/45 (57.78%), Postives = 34/45 (75.56%), Query Frame = 1 Query: 22 FEIKRST-SVTQPFYFVLKAVNTETILTSETYTSKQGCENGITSV 153 F IK+S + +QP+YF+LKA N ETI TSE Y+SK+ C+ GI SV Sbjct: 4 FVIKKSEKNNSQPYYFLLKAANHETIATSEMYSSKEACKKGIASV 48
BLAST of mRNA_M-pyrifera_M_contig90423.20962.1 vs. uniprot
Match: A0A1V2BCP3_9BACT (Uncharacterized protein n=1 Tax=[Flexibacter] sp. ATCC 35208 TaxID=1936242 RepID=A0A1V2BCP3_9BACT) HSP 1 Score: 49.3 bits (116), Expect = 3.590e-6 Identity = 27/49 (55.10%), Postives = 36/49 (73.47%), Query Frame = 1 Query: 7 MSYPRFEIKRSTSVTQPFYFVLKAVNTETILTSETYTSKQGCENGITSV 153 M+ P+F++ +S+ FYF LKA N++TIL+SE Y SKQG ENGI SV Sbjct: 1 MANPKFDLFKSSG---EFYFHLKAENSQTILSSEGYISKQGAENGIKSV 46
BLAST of mRNA_M-pyrifera_M_contig90423.20962.1 vs. uniprot
Match: A0A5C8LZ90_9FLAO (DUF1508 domain-containing protein n=1 Tax=Mesonia sp. K4-1 TaxID=2602760 RepID=A0A5C8LZ90_9FLAO) HSP 1 Score: 48.9 bits (115), Expect = 4.980e-6 Identity = 24/32 (75.00%), Postives = 26/32 (81.25%), Query Frame = 1 Query: 58 FYFVLKAVNTETILTSETYTSKQGCENGITSV 153 FYF L+A N+E ILTSE YTSKQGC NGI SV Sbjct: 14 FYFTLRAANSEIILTSEGYTSKQGCINGINSV 45 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig90423.20962.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig90423.20962.1 >prot_M-pyrifera_M_contig90423.20962.1 ID=prot_M-pyrifera_M_contig90423.20962.1|Name=mRNA_M-pyrifera_M_contig90423.20962.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=49bp MSYPRFEIKRSTSVTQPFYFVLKAVNTETILTSETYTSKQGCENGITSVback to top mRNA from alignment at M-pyrifera_M_contig90423:1..153- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig90423.20962.1 ID=mRNA_M-pyrifera_M_contig90423.20962.1|Name=mRNA_M-pyrifera_M_contig90423.20962.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=153bp|location=Sequence derived from alignment at M-pyrifera_M_contig90423:1..153- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig90423:1..153- >mRNA_M-pyrifera_M_contig90423.20962.1 ID=mRNA_M-pyrifera_M_contig90423.20962.1|Name=mRNA_M-pyrifera_M_contig90423.20962.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=294bp|location=Sequence derived from alignment at M-pyrifera_M_contig90423:1..153- (Macrocystis pyrifera P11B4 male)back to top |