prot_M-pyrifera_M_contig90172.20894.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig90172.20894.1 vs. uniprot
Match: UPI0003812ABE (glycosyltransferase n=1 Tax=Balneola vulgaris TaxID=287535 RepID=UPI0003812ABE) HSP 1 Score: 104 bits (259), Expect = 2.070e-24 Identity = 52/111 (46.85%), Postives = 75/111 (67.57%), Query Frame = 0 Query: 1 QQRRWLRGGFESQWSFKIWLALGFGFHFSISLLFLTGLFFSLQTSLFVLALKFLSDLFMLTSQKILLRKKNILRYFPIQFVYILLIMIWLPASVVINSKISWKGEGYEIKY 111 QQRRWL+GGFE W + I L L FGFH +S+LF+TGLF SL+T++ L +K +D +L S+K LL++ +LRY +++ ++WLP S++INS I W G+ Y I Y Sbjct: 240 QQRRWLKGGFEGSWKYWIGLVLAFGFHNVLSILFVTGLFVSLKTTMIALIIKTGADFLLLASEKTLLKEPKLLRYLFFMEFHLITTLLWLPISLLINSTIHWMGDDYVITY 350 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig90172.20894.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig90172.20894.1 ID=prot_M-pyrifera_M_contig90172.20894.1|Name=mRNA_M-pyrifera_M_contig90172.20894.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=113bpback to top |