mRNA_M-pyrifera_M_contig90172.20894.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig90172.20894.1 vs. uniprot
Match: UPI0003812ABE (glycosyltransferase n=1 Tax=Balneola vulgaris TaxID=287535 RepID=UPI0003812ABE) HSP 1 Score: 104 bits (259), Expect = 2.070e-24 Identity = 52/111 (46.85%), Postives = 75/111 (67.57%), Query Frame = 1 Query: 1 QQRRWLRGGFESQWSFKIWLALGFGFHFSISLLFLTGLFFSLQTSLFVLALKFLSDLFMLTSQKILLRKKNILRYFPIQFVYILLIMIWLPASVVINSKISWKGEGYEIKY 333 QQRRWL+GGFE W + I L L FGFH +S+LF+TGLF SL+T++ L +K +D +L S+K LL++ +LRY +++ ++WLP S++INS I W G+ Y I Y Sbjct: 240 QQRRWLKGGFEGSWKYWIGLVLAFGFHNVLSILFVTGLFVSLKTTMIALIIKTGADFLLLASEKTLLKEPKLLRYLFFMEFHLITTLLWLPISLLINSTIHWMGDDYVITY 350 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig90172.20894.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig90172.20894.1 >prot_M-pyrifera_M_contig90172.20894.1 ID=prot_M-pyrifera_M_contig90172.20894.1|Name=mRNA_M-pyrifera_M_contig90172.20894.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=113bp QQRRWLRGGFESQWSFKIWLALGFGFHFSISLLFLTGLFFSLQTSLFVLAback to top mRNA from alignment at M-pyrifera_M_contig90172:2..340+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig90172.20894.1 ID=mRNA_M-pyrifera_M_contig90172.20894.1|Name=mRNA_M-pyrifera_M_contig90172.20894.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=339bp|location=Sequence derived from alignment at M-pyrifera_M_contig90172:2..340+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig90172:2..340+ >mRNA_M-pyrifera_M_contig90172.20894.1 ID=mRNA_M-pyrifera_M_contig90172.20894.1|Name=mRNA_M-pyrifera_M_contig90172.20894.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=678bp|location=Sequence derived from alignment at M-pyrifera_M_contig90172:2..340+ (Macrocystis pyrifera P11B4 male)back to top |