prot_M-pyrifera_M_contig89784.20813.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig89784.20813.1 vs. uniprot
Match: A0A396JAS7_MEDTR (Putative RNA-directed DNA polymerase n=3 Tax=Medicago truncatula TaxID=3880 RepID=A0A396JAS7_MEDTR) HSP 1 Score: 49.7 bits (117), Expect = 3.060e-5 Identity = 24/61 (39.34%), Postives = 38/61 (62.30%), Query Frame = 0 Query: 10 WVSDNGSTNHVTSDARNVYDWVEIPPGKERVLIGDGKGMRVTGVGSLNLK--MHSKTDFNV 68 W D+G+T+HVT DA N+ D + G ++V IG+G+G+ +T VGSL +H +T + Sbjct: 336 WYPDSGATHHVTPDASNLMDSTSLS-GSDQVHIGNGQGLAITSVGSLQFTSPLHPQTTLKL 395 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig89784.20813.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig89784.20813.1 ID=prot_M-pyrifera_M_contig89784.20813.1|Name=mRNA_M-pyrifera_M_contig89784.20813.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=68bpback to top |