mRNA_M-pyrifera_M_contig89766.20806.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig89766.20806.1 vs. uniprot
Match: A0A7W1VWH1_9BACT (IPT/TIG domain-containing protein n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A7W1VWH1_9BACT) HSP 1 Score: 55.5 bits (132), Expect = 1.600e-6 Identity = 35/115 (30.43%), Postives = 60/115 (52.17%), Query Frame = 1 Query: 1 GQGTDLVVKVYIQGSWSNSVTYSYSPPIITRLTATEPAESGDPWTLHIVGSNFGVSNEVLVRPLVGGSPYTLLSTVSSSHTTIVVTLSEDEGEVSVQSGGQTSNSRIYSQASPII 345 G GT V V + G S +++++Y+PP IT + T SG+ + + G++FG S VL G+P + S S +V + +SV +GGQ SN ++++ +SP + Sbjct: 411 GVGTGHTVSVSVGGQDSGALSFNYNPPFITDVFPTSAPTSGNT-LVTLTGASFGTSGTVLFN----GNPCAISSYTHSQIQFVVPPGQGMDNSISVVTGGQPSNMKLFNYSSPSV 520 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig89766.20806.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig89766.20806.1 >prot_M-pyrifera_M_contig89766.20806.1 ID=prot_M-pyrifera_M_contig89766.20806.1|Name=mRNA_M-pyrifera_M_contig89766.20806.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=115bp GQGTDLVVKVYIQGSWSNSVTYSYSPPIITRLTATEPAESGDPWTLHIVGback to top mRNA from alignment at M-pyrifera_M_contig89766:178..522+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig89766.20806.1 ID=mRNA_M-pyrifera_M_contig89766.20806.1|Name=mRNA_M-pyrifera_M_contig89766.20806.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=345bp|location=Sequence derived from alignment at M-pyrifera_M_contig89766:178..522+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig89766:178..522+ >mRNA_M-pyrifera_M_contig89766.20806.1 ID=mRNA_M-pyrifera_M_contig89766.20806.1|Name=mRNA_M-pyrifera_M_contig89766.20806.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=690bp|location=Sequence derived from alignment at M-pyrifera_M_contig89766:178..522+ (Macrocystis pyrifera P11B4 male)back to top |