prot_M-pyrifera_M_contig89626.20782.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig89626.20782.1 vs. uniprot
Match: A0A136LQ60_9BACT (Uncharacterized protein n=1 Tax=Bacteroidetes bacterium OLB12 TaxID=1619897 RepID=A0A136LQ60_9BACT) HSP 1 Score: 56.2 bits (134), Expect = 6.360e-6 Identity = 36/95 (37.89%), Postives = 47/95 (49.47%), Query Frame = 0 Query: 21 LWGVNAAGGNEIDTEIDAGTLFNFDPELKQLDVNFSFESYPNGNRPGGRLIFIEN-KAYGTTADGGENYQGVLYLYDLDTEEKTALHHFDSETGS 114 L+G+ + GG+ + G +F FDP SF+ PNG+ P G LI N K YG T+ GG GVL+ YDL T E F S G+ Sbjct: 74 LYGLTSEGGSH-----NRGVIFEFDPASSVYKPLQSFQG-PNGSAPRGSLIVGANGKLYGMTSAGGNTDDGVLFEYDLSTNELNKKFDFSSTQGA 162
BLAST of mRNA_M-pyrifera_M_contig89626.20782.1 vs. uniprot
Match: UPI002020894D (T9SS type A sorting domain-containing protein n=1 Tax=Polaribacter sp. Z022 TaxID=2927125 RepID=UPI002020894D) HSP 1 Score: 55.8 bits (133), Expect = 8.620e-6 Identity = 39/110 (35.45%), Postives = 50/110 (45.45%), Query Frame = 0 Query: 10 YTSISAQHKPTLWGVNAAGGNEIDTEIDAGTLFNFDPELKQLDVNFSF----ESYPNGNRPGGRLIFIEN-KAYGTTADGGENYQGVLYLYDLDTEEKTALHHFDSETGS 114 Y S+ + L+G+ AA G D G +F FD V F S G+ P G LI N YG T GG N +GV++ Y++ T T LH FD TGS Sbjct: 65 YGSLLLANNGKLYGMTAAYGKTQD-----GVIFEFDIATNNYVVIHDFYDSVSSNSTGSTPYGSLIQANNGNLYGVTNKGGLNGRGVIFEYNITTNNFTKLHDFDYSTGS 169
BLAST of mRNA_M-pyrifera_M_contig89626.20782.1 vs. uniprot
Match: A0A7Y7AGH0_9FLAO (T9SS type A sorting domain-containing protein n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A7Y7AGH0_9FLAO) HSP 1 Score: 53.5 bits (127), Expect = 6.020e-5 Identity = 35/95 (36.84%), Postives = 47/95 (49.47%), Query Frame = 0 Query: 22 WGVNAAGGNEIDTEIDAGTLFNFDPELKQLDVNFSFESYPNGNRPGGRLIFIEN-KAYGTTADGGENYQGVLYLYDLDTEEKTALHHFDSETGSF 115 +G+ A+GG D G L+ +DP L+ L + F S +G P G L+ N K YG T GG GVL+ YDL+T T FD G + Sbjct: 495 YGLTASGGLN-----DRGVLYEWDPNLELLTKKYDF-STASGYFPLGNLVEANNGKLYGLTGYGGAADFGVLFEYDLNTNTYTIKAEFDGTNGQY 583
BLAST of mRNA_M-pyrifera_M_contig89626.20782.1 vs. uniprot
Match: A0A1F3PPQ3_9BACT (Por_Secre_tail domain-containing protein n=1 Tax=Bacteroidetes bacterium RIFOXYA12_FULL_38_20 TaxID=1797368 RepID=A0A1F3PPQ3_9BACT) HSP 1 Score: 53.1 bits (126), Expect = 8.520e-5 Identity = 29/79 (36.71%), Postives = 44/79 (55.70%), Query Frame = 0 Query: 39 GTLFNFDPELKQLDVNFSFESYPNGNRPGGRLIFIENKA-YGTTADGGENYQGVLYLYDLDTEEKTALHHF-DSETGSF 115 G ++ +DP LK+ F F+ +G+ P LI +N YGT A GG GV++ +D+ T T L+ F DS +GS+ Sbjct: 443 GVIYEYDPALKKYTKLFDFDGVNSGSHPYSGLIQADNGLLYGTAAGGGSYNFGVIFSFDIATNNFTKLYDFNDSTSGSY 521 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig89626.20782.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 4
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig89626.20782.1 ID=prot_M-pyrifera_M_contig89626.20782.1|Name=mRNA_M-pyrifera_M_contig89626.20782.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=194bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|