mRNA_M-pyrifera_M_contig89619.20778.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig89619.20778.1 vs. uniprot
Match: A0A7X7KBU0_9BACT (Protein kinase (Fragment) n=1 Tax=Pirellulaceae bacterium TaxID=2699754 RepID=A0A7X7KBU0_9BACT) HSP 1 Score: 72.8 bits (177), Expect = 1.020e-12 Identity = 47/105 (44.76%), Postives = 59/105 (56.19%), Query Frame = 1 Query: 1 LTKLQAAQAPRIVDICQLAPETPQPLATAIAACLRMRPEHRPESFARLSAMLGPATKRDTAALAGFMRGEGPGRVRLRTTASTARHSRWTSVWAAATAGCLVSLA 315 L+KL++A+ I D+ + AP+ P PLA AIA+C P RPES ARLSAMLGP T+ L + G VRL T A + R S +W A A C V LA Sbjct: 283 LSKLRSAEECLIRDVREYAPDAPPPLAAAIASCAWKDPRRRPESMARLSAMLGPPTRDGRERLIAALNRRGRPAVRLTTAARSIRRSNNAPIWLTAAACCAVLLA 387 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig89619.20778.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig89619.20778.1 >prot_M-pyrifera_M_contig89619.20778.1 ID=prot_M-pyrifera_M_contig89619.20778.1|Name=mRNA_M-pyrifera_M_contig89619.20778.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=108bp LTKLQAAQAPRIVDICQLAPETPQPLATAIAACLRMRPEHRPESFARLSAback to top mRNA from alignment at M-pyrifera_M_contig89619:2..325+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig89619.20778.1 ID=mRNA_M-pyrifera_M_contig89619.20778.1|Name=mRNA_M-pyrifera_M_contig89619.20778.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=324bp|location=Sequence derived from alignment at M-pyrifera_M_contig89619:2..325+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig89619:2..325+ >mRNA_M-pyrifera_M_contig89619.20778.1 ID=mRNA_M-pyrifera_M_contig89619.20778.1|Name=mRNA_M-pyrifera_M_contig89619.20778.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=648bp|location=Sequence derived from alignment at M-pyrifera_M_contig89619:2..325+ (Macrocystis pyrifera P11B4 male)back to top |