prot_M-pyrifera_M_contig89203.20677.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig89203.20677.1 vs. uniprot
Match: F2TZB6_SALR5 (JmjC domain-containing protein n=1 Tax=Salpingoeca rosetta (strain ATCC 50818 / BSB-021) TaxID=946362 RepID=F2TZB6_SALR5) HSP 1 Score: 67.0 bits (162), Expect = 1.730e-10 Identity = 45/138 (32.61%), Postives = 65/138 (47.10%), Query Frame = 0 Query: 1 VRAGLVPYASTYAGAEMNATTMDLGDYITSYLLNPNPNP-----------TLTPPLYVFDNEVLTKSFVVANSLPIPSFNTSIRQFI-----IGPKDSGAMPHIHDGAWNILFLGRKLWVITPPSCAEFALLPASEWF 122 V VPYASTY + + TM L ++ ++ N + T +YVFD VL + + +S+ +P +S Q + +GP SGA PH H A N+L GRK W + PP A F ++ A WF Sbjct: 382 VSVAAVPYASTYGHSTTH--TMPLRTFVQQHMGYSNNHHQXXXXQAQDCRTTDTCMYVFDGSVLHRHPEMLHSIGLPFVVSSTEQLVLAQLMVGPTGSGAPPHFHGQAINVLVQGRKQWQLFPPQHAFFHMVTAHAWF 517 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig89203.20677.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig89203.20677.1 ID=prot_M-pyrifera_M_contig89203.20677.1|Name=mRNA_M-pyrifera_M_contig89203.20677.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=122bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|