prot_M-pyrifera_M_contig88853.20621.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig88853.20621.1 vs. uniprot
Match: A0A1X7VF94_AMPQE (Uncharacterized protein n=1 Tax=Amphimedon queenslandica TaxID=400682 RepID=A0A1X7VF94_AMPQE) HSP 1 Score: 59.7 bits (143), Expect = 2.370e-8 Identity = 30/72 (41.67%), Postives = 44/72 (61.11%), Query Frame = 0 Query: 8 ASVVHVVAYLEDQHIRQWPVEKRSPLREE-GEGWGSVFVRYLRDAECPFAPDLAPSSSXXXXXXPAVPPSFT 78 A + +V +LEDQ IR + +++R+PLR+E G+ W VF +YL D +CPF+ D AP+ AV FT Sbjct: 30 AQLKSLVIWLEDQKIRHYTIDERTPLRDETGDNWNKVFEKYLTDMQCPFSFDSAPTPCLHWLIDEAVRCEFT 101
BLAST of mRNA_M-pyrifera_M_contig88853.20621.1 vs. uniprot
Match: A0A2L2XVB6_PARTP (Uncharacterized protein n=1 Tax=Parasteatoda tepidariorum TaxID=114398 RepID=A0A2L2XVB6_PARTP) HSP 1 Score: 49.7 bits (117), Expect = 9.180e-5 Identity = 29/89 (32.58%), Postives = 39/89 (43.82%), Query Frame = 0 Query: 14 VAYLEDQHIRQWPVEKRSPLRE-EGEGWGSVFVRYLRDAECPFAPDLAPSSSXXXXXXPAVPPSFTPEELHRLVQWLLGQAICVDFEES 101 V +LEDQ IRQ+P+E RSPLR W F YL D CPF E + WLLG A+ +++ ++ Sbjct: 30 VVWLEDQVIRQYPIEDRSPLRNITNAAWEDAFKVYLADLACPFT------------------------EKEEICDWLLGLAVRLEYGDN 94 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig88853.20621.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig88853.20621.1 ID=prot_M-pyrifera_M_contig88853.20621.1|Name=mRNA_M-pyrifera_M_contig88853.20621.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=106bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|