mRNA_M-pyrifera_M_contig8731.20294.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig8731.20294.1 vs. uniprot
Match: A0A6H5JLA9_9PHAE (HeH domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JLA9_9PHAE) HSP 1 Score: 62.0 bits (149), Expect = 7.460e-10 Identity = 28/49 (57.14%), Postives = 36/49 (73.47%), Query Frame = 1 Query: 13 DDDWAVLSPAELKRKTVAQLKGYLDEEGVGYPGKVKKADLLDIVTSFLA 159 D DW LS + RKTVA LK +LDEEG+ YP K+KKA+L+D+V + LA Sbjct: 914 DGDWGALSAKAVGRKTVAALKEFLDEEGIDYPSKIKKAELVDMVLNMLA 962
BLAST of mRNA_M-pyrifera_M_contig8731.20294.1 vs. uniprot
Match: D7FLN9_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FLN9_ECTSI) HSP 1 Score: 61.2 bits (147), Expect = 1.390e-9 Identity = 28/49 (57.14%), Postives = 36/49 (73.47%), Query Frame = 1 Query: 13 DDDWAVLSPAELKRKTVAQLKGYLDEEGVGYPGKVKKADLLDIVTSFLA 159 D DW LS + RKTVA LK +LDEEG+ YP K+KKA+L+D+V + LA Sbjct: 563 DGDWGALSAKAVGRKTVAALKEFLDEEGMDYPSKIKKAELVDMVLNMLA 611 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig8731.20294.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig8731.20294.1 >prot_M-pyrifera_M_contig8731.20294.1 ID=prot_M-pyrifera_M_contig8731.20294.1|Name=mRNA_M-pyrifera_M_contig8731.20294.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=54bp MEGVDDDWAVLSPAELKRKTVAQLKGYLDEEGVGYPGKVKKADLLDIVTSback to top mRNA from alignment at M-pyrifera_M_contig8731:10940..11101- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig8731.20294.1 ID=mRNA_M-pyrifera_M_contig8731.20294.1|Name=mRNA_M-pyrifera_M_contig8731.20294.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=162bp|location=Sequence derived from alignment at M-pyrifera_M_contig8731:10940..11101- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig8731:10940..11101- >mRNA_M-pyrifera_M_contig8731.20294.1 ID=mRNA_M-pyrifera_M_contig8731.20294.1|Name=mRNA_M-pyrifera_M_contig8731.20294.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=324bp|location=Sequence derived from alignment at M-pyrifera_M_contig8731:10940..11101- (Macrocystis pyrifera P11B4 male)back to top |