mRNA_M-pyrifera_M_contig8730.20290.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig8730.20290.1 vs. uniprot
Match: D7FIW5_ECTSI (RING-type domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FIW5_ECTSI) HSP 1 Score: 80.5 bits (197), Expect = 1.700e-16 Identity = 37/44 (84.09%), Postives = 38/44 (86.36%), Query Frame = 1 Query: 1 ELDRARKCVACLMRERDTLLFPCKHLVLCGACYKRVVHQAERDA 132 ELDRARKCVACL R+RDTLLFPCKHLVLC CY RVV QAE DA Sbjct: 608 ELDRARKCVACLSRDRDTLLFPCKHLVLCSQCYTRVVRQAEDDA 651
BLAST of mRNA_M-pyrifera_M_contig8730.20290.1 vs. uniprot
Match: A0A383VPS7_TETOB (RING-type E3 ubiquitin transferase n=1 Tax=Tetradesmus obliquus TaxID=3088 RepID=A0A383VPS7_TETOB) HSP 1 Score: 47.4 bits (111), Expect = 8.050e-5 Identity = 22/42 (52.38%), Postives = 26/42 (61.90%), Query Frame = 1 Query: 1 ELDRARKCVACLMRERDTLLFPCKHLVLCGACYKRVVHQAER 126 +L +A CV CL RDTLL PCKHLVLC C + A+R Sbjct: 713 QLHQATHCVVCLDAPRDTLLLPCKHLVLCQGCSCHLQQLAQR 754 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig8730.20290.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig8730.20290.1 >prot_M-pyrifera_M_contig8730.20290.1 ID=prot_M-pyrifera_M_contig8730.20290.1|Name=mRNA_M-pyrifera_M_contig8730.20290.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=47bp ELDRARKCVACLMRERDTLLFPCKHLVLCGACYKRVVHQAERDADADback to top mRNA from alignment at M-pyrifera_M_contig8730:9726..9866- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig8730.20290.1 ID=mRNA_M-pyrifera_M_contig8730.20290.1|Name=mRNA_M-pyrifera_M_contig8730.20290.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=141bp|location=Sequence derived from alignment at M-pyrifera_M_contig8730:9726..9866- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig8730:9726..9866- >mRNA_M-pyrifera_M_contig8730.20290.1 ID=mRNA_M-pyrifera_M_contig8730.20290.1|Name=mRNA_M-pyrifera_M_contig8730.20290.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=282bp|location=Sequence derived from alignment at M-pyrifera_M_contig8730:9726..9866- (Macrocystis pyrifera P11B4 male)back to top |