mRNA_M-pyrifera_M_contig87041.20240.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig87041.20240.1 vs. uniprot
Match: A0A061QZZ9_9CHLO (CRAL-TRIO domain-containing protein (Fragment) n=1 Tax=Tetraselmis sp. GSL018 TaxID=582737 RepID=A0A061QZZ9_9CHLO) HSP 1 Score: 49.3 bits (116), Expect = 6.930e-5 Identity = 22/65 (33.85%), Postives = 37/65 (56.92%), Query Frame = 1 Query: 1 WVVDFSGYGLVHATNTSLGTRLANATSTRFPERLSGLILVDAPYIFQAFLAVCRALLDATTMNKV 195 WV+DF G+G+ N + + TST +PERLS +++V AP +F ++ R ++ T K+ Sbjct: 71 WVMDFHGFGMADC-NPKIAKIFLSLTSTHYPERLSNIVVVGAPALFNGLWSMLRPMVPDVTKEKI 134
BLAST of mRNA_M-pyrifera_M_contig87041.20240.1 vs. uniprot
Match: A0A061SFM8_9CHLO (CRAL-TRIO domain-containing protein n=1 Tax=Tetraselmis sp. GSL018 TaxID=582737 RepID=A0A061SFM8_9CHLO) HSP 1 Score: 50.1 bits (118), Expect = 7.960e-5 Identity = 29/99 (29.29%), Postives = 52/99 (52.53%), Query Frame = 1 Query: 1 WVVDFSGYGLVHATNTSLGTRLANATSTRFPERLSGLILVDAPYIFQAFLAVCRALLDATTMNKVVAV-----SK---SELQGKLESTMPADMAEYIDA 273 WV+DF G+G+ N + + TST +PERLS +++V AP +F ++ R ++ T K+ V SK S+++ L+ ++ E++ A Sbjct: 136 WVMDFHGFGMADC-NPKIAKIFLSLTSTHYPERLSNIVVVGAPALFNGLWSMLRPMVPDVTKEKIRFVPYDAESKTRGSQMRAALKDIFSEELLEWLIA 233 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig87041.20240.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig87041.20240.1 >prot_M-pyrifera_M_contig87041.20240.1 ID=prot_M-pyrifera_M_contig87041.20240.1|Name=mRNA_M-pyrifera_M_contig87041.20240.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=107bp WVVDFSGYGLVHATNTSLGTRLANATSTRFPERLSGLILVDAPYIFQAFLback to top mRNA from alignment at M-pyrifera_M_contig87041:84..537- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig87041.20240.1 ID=mRNA_M-pyrifera_M_contig87041.20240.1|Name=mRNA_M-pyrifera_M_contig87041.20240.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=454bp|location=Sequence derived from alignment at M-pyrifera_M_contig87041:84..537- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig87041:84..537- >mRNA_M-pyrifera_M_contig87041.20240.1 ID=mRNA_M-pyrifera_M_contig87041.20240.1|Name=mRNA_M-pyrifera_M_contig87041.20240.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=642bp|location=Sequence derived from alignment at M-pyrifera_M_contig87041:84..537- (Macrocystis pyrifera P11B4 male)back to top |