prot_M-pyrifera_M_contig86720.20172.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig86720.20172.1 vs. uniprot
Match: A0A482UN69_9ARCH (START domain-containing protein (Fragment) n=1 Tax=archaeon TaxID=1906665 RepID=A0A482UN69_9ARCH) HSP 1 Score: 94.0 bits (232), Expect = 4.020e-21 Identity = 51/107 (47.66%), Postives = 59/107 (55.14%), Query Frame = 0 Query: 1 ADQVADAITDLELYASWDRSWEQVQPVR-LLDHHNQILRFVADQPPPPVSNILTQRDFVMSRDFRRDPDTGTFVVLFRNVQHRRSPPLPDKIRANTLGVIGFVVRSV 106 A DAIT LE Y WDR+W VQP+ LD N F+AD PPPP S ++ RDFVM R RDP G V + RN HR P P IR TL +GF+V V Sbjct: 66 AQDAFDAITRLEKYRRWDRTWHLVQPIGDPLDAFNAAYYFIADSPPPPYSYLIVARDFVMLRFTYRDPYAGINVDVLRNACHRAKPADPVYIRGETLSCVGFMVTPV 172 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig86720.20172.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig86720.20172.1 ID=prot_M-pyrifera_M_contig86720.20172.1|Name=mRNA_M-pyrifera_M_contig86720.20172.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=108bpback to top |