mRNA_M-pyrifera_M_contig86720.20172.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig86720.20172.1 vs. uniprot
Match: A0A482UN69_9ARCH (START domain-containing protein (Fragment) n=1 Tax=archaeon TaxID=1906665 RepID=A0A482UN69_9ARCH) HSP 1 Score: 94.0 bits (232), Expect = 4.020e-21 Identity = 51/107 (47.66%), Postives = 59/107 (55.14%), Query Frame = 1 Query: 1 ADQVADAITDLELYASWDRSWEQVQPVR-LLDHHNQILRFVADQPPPPVSNILTQRDFVMSRDFRRDPDTGTFVVLFRNVQHRRSPPLPDKIRANTLGVIGFVVRSV 318 A DAIT LE Y WDR+W VQP+ LD N F+AD PPPP S ++ RDFVM R RDP G V + RN HR P P IR TL +GF+V V Sbjct: 66 AQDAFDAITRLEKYRRWDRTWHLVQPIGDPLDAFNAAYYFIADSPPPPYSYLIVARDFVMLRFTYRDPYAGINVDVLRNACHRAKPADPVYIRGETLSCVGFMVTPV 172 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig86720.20172.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig86720.20172.1 >prot_M-pyrifera_M_contig86720.20172.1 ID=prot_M-pyrifera_M_contig86720.20172.1|Name=mRNA_M-pyrifera_M_contig86720.20172.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=108bp ADQVADAITDLELYASWDRSWEQVQPVRLLDHHNQILRFVADQPPPPVSNback to top mRNA from alignment at M-pyrifera_M_contig86720:9..332- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig86720.20172.1 ID=mRNA_M-pyrifera_M_contig86720.20172.1|Name=mRNA_M-pyrifera_M_contig86720.20172.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=324bp|location=Sequence derived from alignment at M-pyrifera_M_contig86720:9..332- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig86720:9..332- >mRNA_M-pyrifera_M_contig86720.20172.1 ID=mRNA_M-pyrifera_M_contig86720.20172.1|Name=mRNA_M-pyrifera_M_contig86720.20172.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=648bp|location=Sequence derived from alignment at M-pyrifera_M_contig86720:9..332- (Macrocystis pyrifera P11B4 male)back to top |