prot_M-pyrifera_M_contig8667.20160.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig8667.20160.1 vs. uniprot
Match: A0A6H5JH29_9PHAE (Ubiquitin-like domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JH29_9PHAE) HSP 1 Score: 68.9 bits (167), Expect = 1.570e-13 Identity = 34/49 (69.39%), Postives = 40/49 (81.63%), Query Frame = 0 Query: 1 MTVRILDVKGQIYKLVVRPETTVHELKTRLVEEAGVEIARQRIIYGGKV 49 MTVR+LDV+GQ Y L V PET+V ELK LV+ AGVE+ RQRII+GGKV Sbjct: 83 MTVRVLDVRGQFYPLRVTPETSVRELKLMLVDAAGVEVPRQRIIHGGKV 131
BLAST of mRNA_M-pyrifera_M_contig8667.20160.1 vs. uniprot
Match: D8LJ71_ECTSI (Ubiquitin-like domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LJ71_ECTSI) HSP 1 Score: 67.8 bits (164), Expect = 5.380e-12 Identity = 33/49 (67.35%), Postives = 40/49 (81.63%), Query Frame = 0 Query: 1 MTVRILDVKGQIYKLVVRPETTVHELKTRLVEEAGVEIARQRIIYGGKV 49 MTVR+LDV+GQ Y L V PET+V ELK LV+ AGVE+ RQRII+GGK+ Sbjct: 84 MTVRVLDVRGQFYPLRVTPETSVRELKLMLVDAAGVEVPRQRIIHGGKM 132 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig8667.20160.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig8667.20160.1 ID=prot_M-pyrifera_M_contig8667.20160.1|Name=mRNA_M-pyrifera_M_contig8667.20160.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=49bpback to top |