prot_M-pyrifera_M_contig86651.20158.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig86651.20158.1 vs. uniprot
Match: A0A2T9YT82_9FUNG (Uncharacterized protein n=1 Tax=Smittium simulii TaxID=133385 RepID=A0A2T9YT82_9FUNG) HSP 1 Score: 49.3 bits (116), Expect = 4.650e-5 Identity = 22/50 (44.00%), Postives = 30/50 (60.00%), Query Frame = 0 Query: 1 MVAEKYKKCCPCCGKEVPETLKHIMLRCRRWKKGREEMLGSMIREANKLT 50 ++++ YKK CPCC PET++HI+L C RW R E + I KLT Sbjct: 601 LISKLYKKKCPCCNANFPETIEHILLGCSRWAAIRAETIRKFIPRLYKLT 650 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig86651.20158.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig86651.20158.1 ID=prot_M-pyrifera_M_contig86651.20158.1|Name=mRNA_M-pyrifera_M_contig86651.20158.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=71bpback to top |