mRNA_M-pyrifera_M_contig86527.20137.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig86527.20137.1 vs. uniprot
Match: A0A7V8V7P3_9BACT (Uncharacterized protein n=1 Tax=Bremerella alba TaxID=980252 RepID=A0A7V8V7P3_9BACT) HSP 1 Score: 67.8 bits (164), Expect = 1.340e-9 Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = 1 Query: 610 IVTRTGVTGEGAATLATQLPETEIQHVYKPEN 705 IVTRTGVTGEGAATLATQLPETEIQHVYKPEN Sbjct: 326 IVTRTGVTGEGAATLATQLPETEIQHVYKPEN 357
BLAST of mRNA_M-pyrifera_M_contig86527.20137.1 vs. uniprot
Match: A0A518C479_9BACT (Leucine Rich repeats (2 copies) n=1 Tax=Bremerella volcania TaxID=2527984 RepID=A0A518C479_9BACT) HSP 1 Score: 54.7 bits (130), Expect = 3.790e-5 Identity = 26/32 (81.25%), Postives = 27/32 (84.38%), Query Frame = 1 Query: 610 IVTRTGVTGEGAATLATQLPETEIQHVYKPEN 705 IVTRTGVT EGAA LA +LPETEIQHVY EN Sbjct: 326 IVTRTGVTSEGAAALANKLPETEIQHVYMTEN 357 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig86527.20137.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig86527.20137.1 >prot_M-pyrifera_M_contig86527.20137.1 ID=prot_M-pyrifera_M_contig86527.20137.1|Name=mRNA_M-pyrifera_M_contig86527.20137.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=236bp QICQCGKLKNLQFRGNPITDADLKHVGRLTQLKVLGLDETAVEGATFDRLback to top mRNA from alignment at M-pyrifera_M_contig86527:3..710+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig86527.20137.1 ID=mRNA_M-pyrifera_M_contig86527.20137.1|Name=mRNA_M-pyrifera_M_contig86527.20137.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=708bp|location=Sequence derived from alignment at M-pyrifera_M_contig86527:3..710+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig86527:3..710+ >mRNA_M-pyrifera_M_contig86527.20137.1 ID=mRNA_M-pyrifera_M_contig86527.20137.1|Name=mRNA_M-pyrifera_M_contig86527.20137.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=1416bp|location=Sequence derived from alignment at M-pyrifera_M_contig86527:3..710+ (Macrocystis pyrifera P11B4 male)back to top |