mRNA_M-pyrifera_M_contig86143.20075.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig86143.20075.1 vs. uniprot
Match: D7G6H3_ECTSI (CMP/dCMP-type deaminase domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G6H3_ECTSI) HSP 1 Score: 120 bits (301), Expect = 1.170e-30 Identity = 54/61 (88.52%), Postives = 57/61 (93.44%), Query Frame = 1 Query: 1 LFRVDRVVFGAPNPNLGACGGWVDLPGHKHAFHELEVRGGVLAEDCALPLRRFFRSRRREG 183 LFRVDRVVFGAPNPNLGACGGWVDL +HAFHELEV+GGVLAE+CALPLR FFRSRRREG Sbjct: 431 LFRVDRVVFGAPNPNLGACGGWVDLSSQRHAFHELEVKGGVLAEECALPLRGFFRSRRREG 491
BLAST of mRNA_M-pyrifera_M_contig86143.20075.1 vs. uniprot
Match: A0A6H5L744_9PHAE (CMP/dCMP-type deaminase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L744_9PHAE) HSP 1 Score: 117 bits (294), Expect = 9.070e-30 Identity = 53/60 (88.33%), Postives = 56/60 (93.33%), Query Frame = 1 Query: 1 LFRVDRVVFGAPNPNLGACGGWVDLPGHKHAFHELEVRGGVLAEDCALPLRRFFRSRRRE 180 LFRVDRVVFGAPNPNLGACGGWVDL +HAFHELEV+GGVLAE+CALPLR FFRSRRRE Sbjct: 403 LFRVDRVVFGAPNPNLGACGGWVDLSSQRHAFHELEVKGGVLAEECALPLRGFFRSRRRE 462
BLAST of mRNA_M-pyrifera_M_contig86143.20075.1 vs. uniprot
Match: A0A7S3Y7A9_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3Y7A9_HETAK) HSP 1 Score: 76.6 bits (187), Expect = 3.660e-16 Identity = 34/57 (59.65%), Postives = 45/57 (78.95%), Query Frame = 1 Query: 4 FRVDRVVFGAPNPNLGACGGWVDLPGHKHAFHELEVRGGVLAEDCALPLRRFFRSRR 174 FRV RVV+GA + LGACG ++DLP H+H FH+L+V GGVLAE+ + L++FFR RR Sbjct: 101 FRVRRVVYGARDHRLGACGTYLDLPAHRHPFHQLQVTGGVLAEESSDLLKQFFRERR 157
BLAST of mRNA_M-pyrifera_M_contig86143.20075.1 vs. uniprot
Match: A0A2V3J170_9FLOR (tRNA-specific adenosine deaminase n=1 Tax=Gracilariopsis chorda TaxID=448386 RepID=A0A2V3J170_9FLOR) HSP 1 Score: 71.6 bits (174), Expect = 7.240e-14 Identity = 38/60 (63.33%), Postives = 41/60 (68.33%), Query Frame = 1 Query: 1 LFRVDRVVFGAPNPNLGACGGWVDLPGHKHAFHEL-EVRGGVLAEDCALPLRRFFRSRRR 177 L R+ RVVFGA + LGACG WVDL KH FH L EV GGVLAE A LR FF+ RRR Sbjct: 129 LARIRRVVFGARDLRLGACGTWVDLVNEKHPFHTLDEVVGGVLAEQSAALLRSFFQERRR 188
BLAST of mRNA_M-pyrifera_M_contig86143.20075.1 vs. uniprot
Match: A0A0U5BVA6_9GAMM (tRNA-specific adenosine deaminase n=1 Tax=Thiocapsa sp. KS1 TaxID=610332 RepID=A0A0U5BVA6_9GAMM) HSP 1 Score: 68.6 bits (166), Expect = 3.440e-13 Identity = 32/57 (56.14%), Postives = 40/57 (70.18%), Query Frame = 1 Query: 7 RVDRVVFGAPNPNLGACGGWVDL-PGHKHAFHELEVRGGVLAEDCALPLRRFFRSRR 174 RVDRV++GAP+P GACG +L P + H + RGG+LAEDCA LR FFR+RR Sbjct: 87 RVDRVIYGAPDPKAGACGSVFELLPSNSRFNHRTDCRGGILAEDCAEILRAFFRARR 143
BLAST of mRNA_M-pyrifera_M_contig86143.20075.1 vs. uniprot
Match: UPI00199862B7 (tRNA-specific adenosine deaminase n=2 Tax=Pigmentiphaga litoralis TaxID=516702 RepID=UPI00199862B7) HSP 1 Score: 69.7 bits (169), Expect = 4.500e-13 Identity = 32/56 (57.14%), Postives = 38/56 (67.86%), Query Frame = 1 Query: 7 RVDRVVFGAPNPNLGACGGWVDLPGHKHAFHELEVRGGVLAEDCALPLRRFFRSRR 174 R+ RVVFGAP+P G CGG +DLP H+ V GGVLA +CA LR FFR+RR Sbjct: 109 RLARVVFGAPDPKTGVCGGTIDLPAVAQLNHQTVVEGGVLAAECAALLRAFFRARR 164
BLAST of mRNA_M-pyrifera_M_contig86143.20075.1 vs. uniprot
Match: A0A853H1G2_9BURK (tRNA-specific adenosine deaminase n=1 Tax=Pusillimonas harenae TaxID=657015 RepID=A0A853H1G2_9BURK) HSP 1 Score: 67.4 bits (163), Expect = 1.180e-12 Identity = 32/56 (57.14%), Postives = 39/56 (69.64%), Query Frame = 1 Query: 7 RVDRVVFGAPNPNLGACGGWVDLPGHKHAFHELEVRGGVLAEDCALPLRRFFRSRR 174 R+DRVVFGA +P GACG + + G H+ +V GGVLAE+CA LRRFFR RR Sbjct: 88 RLDRVVFGATDPKTGACGSVLSVHGIVQLNHQTKVEGGVLAEECAELLRRFFRERR 143
BLAST of mRNA_M-pyrifera_M_contig86143.20075.1 vs. uniprot
Match: A0A5C0B810_9BURK (tRNA-specific adenosine deaminase n=1 Tax=Pigmentiphaga aceris TaxID=1940612 RepID=A0A5C0B810_9BURK) HSP 1 Score: 67.4 bits (163), Expect = 1.280e-12 Identity = 31/59 (52.54%), Postives = 40/59 (67.80%), Query Frame = 1 Query: 7 RVDRVVFGAPNPNLGACGGWVDLPGHKHAFHELEVRGGVLAEDCALPLRRFFRSRRREG 183 R+ RVV+GAP+P GACGG +DLP H+ V GGVLA++C LR FFR RR++ Sbjct: 88 RLARVVYGAPDPKTGACGGVIDLPAVGTLNHQTTVVGGVLADECGELLRAFFRERRQQS 146
BLAST of mRNA_M-pyrifera_M_contig86143.20075.1 vs. uniprot
Match: A0A7Y9IVQ4_9BURK (tRNA-specific adenosine deaminase n=2 Tax=Pigmentiphaga litoralis TaxID=516702 RepID=A0A7Y9IVQ4_9BURK) HSP 1 Score: 68.6 bits (166), Expect = 1.870e-12 Identity = 32/56 (57.14%), Postives = 38/56 (67.86%), Query Frame = 1 Query: 7 RVDRVVFGAPNPNLGACGGWVDLPGHKHAFHELEVRGGVLAEDCALPLRRFFRSRR 174 R+ RVVFGAP+P G CGG +DLP H+ V GGVLA +CA LR FFR+RR Sbjct: 152 RLARVVFGAPDPKTGVCGGTIDLPAVAQLNHQTVVEGGVLAAECADLLRAFFRARR 207
BLAST of mRNA_M-pyrifera_M_contig86143.20075.1 vs. uniprot
Match: E7RVG2_9BURK (tRNA-specific adenosine deaminase n=3 Tax=Lautropia TaxID=47670 RepID=E7RVG2_9BURK) HSP 1 Score: 67.4 bits (163), Expect = 3.130e-12 Identity = 29/56 (51.79%), Postives = 38/56 (67.86%), Query Frame = 1 Query: 7 RVDRVVFGAPNPNLGACGGWVDLPGHKHAFHELEVRGGVLAEDCALPLRRFFRSRR 174 R+ RVVFGAP+P G CGG +DLP H+ V+GG+LA++C L+RFF RR Sbjct: 111 RISRVVFGAPDPKTGVCGGVLDLPAEGRLNHQTVVQGGLLADECGKLLQRFFAERR 166 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig86143.20075.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig86143.20075.1 >prot_M-pyrifera_M_contig86143.20075.1 ID=prot_M-pyrifera_M_contig86143.20075.1|Name=mRNA_M-pyrifera_M_contig86143.20075.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=61bp LFRVDRVVFGAPNPNLGACGGWVDLPGHKHAFHELEVRGGVLAEDCALPLback to top mRNA from alignment at M-pyrifera_M_contig86143:246..428+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig86143.20075.1 ID=mRNA_M-pyrifera_M_contig86143.20075.1|Name=mRNA_M-pyrifera_M_contig86143.20075.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=183bp|location=Sequence derived from alignment at M-pyrifera_M_contig86143:246..428+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig86143:246..428+ >mRNA_M-pyrifera_M_contig86143.20075.1 ID=mRNA_M-pyrifera_M_contig86143.20075.1|Name=mRNA_M-pyrifera_M_contig86143.20075.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=366bp|location=Sequence derived from alignment at M-pyrifera_M_contig86143:246..428+ (Macrocystis pyrifera P11B4 male)back to top |