mRNA_M-pyrifera_M_contig86117.20073.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig86117.20073.1 vs. uniprot
Match: A0A2N0DM69_9PSED (RING-type E3 ubiquitin transferase n=3 Tax=Pseudomonas TaxID=286 RepID=A0A2N0DM69_9PSED) HSP 1 Score: 53.5 bits (127), Expect = 1.120e-5 Identity = 44/122 (36.07%), Postives = 65/122 (53.28%), Query Frame = 1 Query: 16 GLEVLVLSFNHLSHLPD-LSSLPSLRRLSASHNRLTSLSFPLEKVPGEMGRLGDIKTLQWLDVGHNYVSSLLPLSGSSSLETLWCQNNRLSDAKGVLRVLETLPSLRGLVVESNPFLTLQNI 378 G+ L L+ N L+ LP+ +++LP+LRRLSASHNRL++ P L + LQ LD+ N++ L +S + LE L NRL G + TLP+LR L + N T+ + Sbjct: 1883 GVHTLELNGNQLTMLPEPVTALPALRRLSASHNRLSAS-------PALQTHLSALTHLQSLDLSQNWLEEL-DVSALTGLERLVLHGNRLVYWPGGVL---TLPALRALDLRDNMIETIPQV 1993 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig86117.20073.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig86117.20073.1 >prot_M-pyrifera_M_contig86117.20073.1 ID=prot_M-pyrifera_M_contig86117.20073.1|Name=mRNA_M-pyrifera_M_contig86117.20073.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=123bp MPGLEVLVLSFNHLSHLPDLSSLPSLRRLSASHNRLTSLSFPLEKVPGEMback to top mRNA from alignment at M-pyrifera_M_contig86117:271..648+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig86117.20073.1 ID=mRNA_M-pyrifera_M_contig86117.20073.1|Name=mRNA_M-pyrifera_M_contig86117.20073.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=378bp|location=Sequence derived from alignment at M-pyrifera_M_contig86117:271..648+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig86117:271..648+ >mRNA_M-pyrifera_M_contig86117.20073.1 ID=mRNA_M-pyrifera_M_contig86117.20073.1|Name=mRNA_M-pyrifera_M_contig86117.20073.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=738bp|location=Sequence derived from alignment at M-pyrifera_M_contig86117:271..648+ (Macrocystis pyrifera P11B4 male)back to top |