mRNA_M-pyrifera_M_contig85868.20017.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig85868.20017.1 vs. uniprot
Match: A0A812LQD8_9DINO (CEP290 protein n=2 Tax=Sar TaxID=2698737 RepID=A0A812LQD8_9DINO) HSP 1 Score: 62.4 bits (150), Expect = 2.680e-8 Identity = 34/47 (72.34%), Postives = 38/47 (80.85%), Query Frame = 1 Query: 343 ARLREENAALQEELGAFDIEFFEELEDLKFRYAAAARKCAAFDAFLA 483 A LR ENAAL+EELGAFD+ FFEELEDLK+R+ A KCAAFD LA Sbjct: 2728 AALRAENAALKEELGAFDVGFFEELEDLKWRHGQAIDKCAAFDRLLA 2774
BLAST of mRNA_M-pyrifera_M_contig85868.20017.1 vs. uniprot
Match: A0A7S3XY01_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3XY01_HETAK) HSP 1 Score: 56.6 bits (135), Expect = 1.560e-6 Identity = 30/46 (65.22%), Postives = 37/46 (80.43%), Query Frame = 1 Query: 331 EKQMARLREENAALQEELGAFDIEFFEELEDLKFRYAAAARKCAAF 468 E++ ARLREENA L EL AFD++FFEE+EDLKF+YA A RK A+ Sbjct: 225 EEENARLREENAKLARELQAFDLDFFEEIEDLKFKYAEAQRKLQAY 270
BLAST of mRNA_M-pyrifera_M_contig85868.20017.1 vs. uniprot
Match: A0A7S2SBL1_9STRA (Hypothetical protein (Fragment) n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2SBL1_9STRA) HSP 1 Score: 55.5 bits (132), Expect = 6.030e-6 Identity = 26/46 (56.52%), Postives = 38/46 (82.61%), Query Frame = 1 Query: 337 QMARLREENAALQEELGAFDIEFFEELEDLKFRYAAAARKCAAFDA 474 ++ RLR+ENA L++EL AFD++FFEE+EDLK++YA A +K F+A Sbjct: 683 ELTRLRDENAKLKQELSAFDLDFFEEIEDLKYKYAEAVKKLRQFEA 728
BLAST of mRNA_M-pyrifera_M_contig85868.20017.1 vs. uniprot
Match: A0A3R6WL93_9STRA (Uncharacterized protein n=1 Tax=Aphanomyces invadans TaxID=157072 RepID=A0A3R6WL93_9STRA) HSP 1 Score: 53.9 bits (128), Expect = 2.180e-5 Identity = 29/46 (63.04%), Postives = 36/46 (78.26%), Query Frame = 1 Query: 346 RLREENAALQEELGAFDIEFFEELEDLKFRYAAAARKCAAFDAFLA 483 RLREENA L EEL AFD++FF+E+EDLKF+YA A R+ A + LA Sbjct: 1291 RLREENARLTEELSAFDLDFFDEIEDLKFKYAQAVRQKQALEKQLA 1336
BLAST of mRNA_M-pyrifera_M_contig85868.20017.1 vs. uniprot
Match: A0A024TQ36_9STRA (Uncharacterized protein n=2 Tax=Aphanomyces invadans TaxID=157072 RepID=A0A024TQ36_9STRA) HSP 1 Score: 53.9 bits (128), Expect = 2.220e-5 Identity = 29/46 (63.04%), Postives = 36/46 (78.26%), Query Frame = 1 Query: 346 RLREENAALQEELGAFDIEFFEELEDLKFRYAAAARKCAAFDAFLA 483 RLREENA L EEL AFD++FF+E+EDLKF+YA A R+ A + LA Sbjct: 1663 RLREENARLTEELSAFDLDFFDEIEDLKFKYAQAVRQKQALEKQLA 1708
BLAST of mRNA_M-pyrifera_M_contig85868.20017.1 vs. uniprot
Match: A0A1V9ZW89_9STRA (Centrosome-associated protein n=1 Tax=Thraustotheca clavata TaxID=74557 RepID=A0A1V9ZW89_9STRA) HSP 1 Score: 53.5 bits (127), Expect = 2.670e-5 Identity = 33/67 (49.25%), Postives = 43/67 (64.18%), Query Frame = 1 Query: 256 VEAIEKEAKEAQEEVRRLKRALEDSEKQMARLREENAALQEELGAFDIEFFEELEDLKFRYAAAARK 456 +EA+E+E + L E+ A+L EENA L EEL AFD+EFFEE+EDLKF+YA A R+ Sbjct: 502 IEALERELSRKSPTTPANEEMLRKLEQHNAQLLEENAKLTEELSAFDLEFFEEIEDLKFKYAEAIRQ 568 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig85868.20017.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 6
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig85868.20017.1 >prot_M-pyrifera_M_contig85868.20017.1 ID=prot_M-pyrifera_M_contig85868.20017.1|Name=mRNA_M-pyrifera_M_contig85868.20017.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=161bp EAAEEAASKLREAERKAESEGREAASLRRALHQAQQAARKAERRIKEMEKback to top mRNA from alignment at M-pyrifera_M_contig85868:258..740- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig85868.20017.1 ID=mRNA_M-pyrifera_M_contig85868.20017.1|Name=mRNA_M-pyrifera_M_contig85868.20017.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=483bp|location=Sequence derived from alignment at M-pyrifera_M_contig85868:258..740- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig85868:258..740- >mRNA_M-pyrifera_M_contig85868.20017.1 ID=mRNA_M-pyrifera_M_contig85868.20017.1|Name=mRNA_M-pyrifera_M_contig85868.20017.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=966bp|location=Sequence derived from alignment at M-pyrifera_M_contig85868:258..740- (Macrocystis pyrifera P11B4 male)back to top |