prot_M-pyrifera_M_contig8575.19997.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig8575.19997.1 vs. uniprot
Match: D8LS33_ECTSI (Conserved Cys-containing small protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LS33_ECTSI) HSP 1 Score: 85.9 bits (211), Expect = 4.430e-19 Identity = 39/59 (66.10%), Postives = 48/59 (81.36%), Query Frame = 0 Query: 1 MLMGLPLSIHRKSYWPVTLAAVAGTAADFMDGNTNCRQQREALLACIARNESAEAAKGQ 59 +L+GLPLS+H+KSYWPVTLAAVAGTAADF +G +CR QREAL+A IAR + +A Q Sbjct: 30 VLLGLPLSVHKKSYWPVTLAAVAGTAADFKEGTADCRPQREALMAFIARKNAGQAKAQQ 88 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig8575.19997.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig8575.19997.1 ID=prot_M-pyrifera_M_contig8575.19997.1|Name=mRNA_M-pyrifera_M_contig8575.19997.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=116bpback to top |