mRNA_M-pyrifera_M_contig8575.19997.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig8575.19997.1 vs. uniprot
Match: D8LS33_ECTSI (Conserved Cys-containing small protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LS33_ECTSI) HSP 1 Score: 98.2 bits (243), Expect = 8.170e-24 Identity = 44/65 (67.69%), Postives = 54/65 (83.08%), Query Frame = 1 Query: 1 QYCAAGMLMGLPLSIHRKSYWPVTLAAVAGTAADFMDGNTNCRQQREALLACIARNESAEAAKGQ 195 +YCAAG+L+GLPLS+H+KSYWPVTLAAVAGTAADF +G +CR QREAL+A IAR + +A Q Sbjct: 24 KYCAAGVLLGLPLSVHKKSYWPVTLAAVAGTAADFKEGTADCRPQREALMAFIARKNAGQAKAQQ 88
BLAST of mRNA_M-pyrifera_M_contig8575.19997.1 vs. uniprot
Match: A0A225VD63_9STRA (Uncharacterized protein n=6 Tax=Phytophthora TaxID=4783 RepID=A0A225VD63_9STRA) HSP 1 Score: 49.3 bits (116), Expect = 3.760e-5 Identity = 23/62 (37.10%), Postives = 36/62 (58.06%), Query Frame = 1 Query: 7 CAAGMLMGLPLSIHRKSYWPVTLAAVAGTAADF-MDGNTNCRQQREALLACIARNESAEAAK 189 C AG+L+G+P+SI RKSY P + V G+ D+ + T+CR A+ + + +AAK Sbjct: 38 CIAGVLVGIPISIQRKSYKPFAILGVLGSFVDYSIPYTTDCRMIHNAMQLALQQERQRDAAK 99
BLAST of mRNA_M-pyrifera_M_contig8575.19997.1 vs. uniprot
Match: A0A2D4BKQ2_PYTIN (Uncharacterized protein n=1 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4BKQ2_PYTIN) HSP 1 Score: 48.5 bits (114), Expect = 7.730e-5 Identity = 26/66 (39.39%), Postives = 36/66 (54.55%), Query Frame = 1 Query: 7 CAAGMLMGLPLSIHRKSYWPVTLAAVAGTAADFMDGNTN-CRQQREAL-LACIARNESAEAAKGQG 198 C AG+L+G+P+S+HRKSY P + V G+ D+ TN CR AL LA + + A G Sbjct: 37 CVAGVLIGIPISVHRKSYKPFAMLGVLGSFIDYSIPYTNDCRMIHNALQLALQQERQQSNAPPSSG 102 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig8575.19997.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig8575.19997.1 >prot_M-pyrifera_M_contig8575.19997.1 ID=prot_M-pyrifera_M_contig8575.19997.1|Name=mRNA_M-pyrifera_M_contig8575.19997.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=116bp MLMGLPLSIHRKSYWPVTLAAVAGTAADFMDGNTNCRQQREALLACIARNback to top mRNA from alignment at M-pyrifera_M_contig8575:883..1933+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig8575.19997.1 ID=mRNA_M-pyrifera_M_contig8575.19997.1|Name=mRNA_M-pyrifera_M_contig8575.19997.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=1051bp|location=Sequence derived from alignment at M-pyrifera_M_contig8575:883..1933+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig8575:883..1933+ >mRNA_M-pyrifera_M_contig8575.19997.1 ID=mRNA_M-pyrifera_M_contig8575.19997.1|Name=mRNA_M-pyrifera_M_contig8575.19997.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=696bp|location=Sequence derived from alignment at M-pyrifera_M_contig8575:883..1933+ (Macrocystis pyrifera P11B4 male)back to top |