prot_M-pyrifera_M_contig85313.19889.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig85313.19889.1 vs. uniprot
Match: A0A5A8EH01_CAFRO (Protein kinase domain-containing protein n=4 Tax=Cafeteria roenbergensis TaxID=33653 RepID=A0A5A8EH01_CAFRO) HSP 1 Score: 77.4 bits (189), Expect = 7.340e-15 Identity = 35/72 (48.61%), Postives = 51/72 (70.83%), Query Frame = 0 Query: 3 SRDPKVYTDLRQVLGIHKGGPHGL--DKKEG-SEQRYIFLLDLIERMTEWDPAIREKPLQALSHPFFRDELD 71 S++ V +DLR+ LG+H GP G D++ G +E+ Y LDLIERM EWDP R +P+QAL+HPF R++++ Sbjct: 483 SQEQAVVSDLREALGVHTFGPKGRRRDERTGHTERHYELFLDLIERMLEWDPRKRVRPMQALNHPFLREDVE 554 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig85313.19889.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig85313.19889.1 ID=prot_M-pyrifera_M_contig85313.19889.1|Name=mRNA_M-pyrifera_M_contig85313.19889.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=77bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|