mRNA_M-pyrifera_M_contig85313.19889.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig85313.19889.1 vs. uniprot
Match: A0A5A8EH01_CAFRO (Protein kinase domain-containing protein n=4 Tax=Cafeteria roenbergensis TaxID=33653 RepID=A0A5A8EH01_CAFRO) HSP 1 Score: 82.4 bits (202), Expect = 1.760e-16 Identity = 40/82 (48.78%), Postives = 58/82 (70.73%), Query Frame = 1 Query: 4 VKPRS-KPMTSRDPKVYTDLRQVLGIHKGGPHGL--DKKEG-SEQRYIFLLDLIERMTEWDPAIREKPLQALSHPFFRDELD 237 +KPRS +P S++ V +DLR+ LG+H GP G D++ G +E+ Y LDLIERM EWDP R +P+QAL+HPF R++++ Sbjct: 473 LKPRSERPGASQEQAVVSDLREALGVHTFGPKGRRRDERTGHTERHYELFLDLIERMLEWDPRKRVRPMQALNHPFLREDVE 554 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig85313.19889.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig85313.19889.1 >prot_M-pyrifera_M_contig85313.19889.1 ID=prot_M-pyrifera_M_contig85313.19889.1|Name=mRNA_M-pyrifera_M_contig85313.19889.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=77bp MTSRDPKVYTDLRQVLGIHKGGPHGLDKKEGSEQRYIFLLDLIERMTEWDback to top mRNA from alignment at M-pyrifera_M_contig85313:554..808- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig85313.19889.1 ID=mRNA_M-pyrifera_M_contig85313.19889.1|Name=mRNA_M-pyrifera_M_contig85313.19889.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=255bp|location=Sequence derived from alignment at M-pyrifera_M_contig85313:554..808- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig85313:554..808- >mRNA_M-pyrifera_M_contig85313.19889.1 ID=mRNA_M-pyrifera_M_contig85313.19889.1|Name=mRNA_M-pyrifera_M_contig85313.19889.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=462bp|location=Sequence derived from alignment at M-pyrifera_M_contig85313:554..808- (Macrocystis pyrifera P11B4 male)back to top |