prot_M-pyrifera_M_contig85298.19881.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig85298.19881.1 vs. uniprot
Match: A0A5A8C9Y4_CAFRO (Uncharacterized protein n=3 Tax=Cafeteria roenbergensis TaxID=33653 RepID=A0A5A8C9Y4_CAFRO) HSP 1 Score: 86.7 bits (213), Expect = 2.330e-17 Identity = 42/110 (38.18%), Postives = 67/110 (60.91%), Query Frame = 0 Query: 2 SGAASLVREVVAQNHVLYDRDLLATGEFMKQALPPKSVVMTNDVHISPIA-ISGRTNLNSYSGWTWSHGLDAAERNRDREEVLRCATQDNNDHCYSLLRKWGVRYLLSKD 110 SGA S++RE +H LY + GEF+++ +PPKSV++ ++ H SP+ ++G +L Y GW WSHG D ER+ DR ++ N Y +R+WGVRY++ ++ Sbjct: 805 SGAVSVIREQ-RMSHELYGPLEIEVGEFIRKNVPPKSVMLHDNNHRSPVGMLAGYPSLAGYDGWLWSHGYDYGERHNDRNYIMDRMGDPNEATIYPKMRRWGVRYVVGEN 913 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig85298.19881.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig85298.19881.1 ID=prot_M-pyrifera_M_contig85298.19881.1|Name=mRNA_M-pyrifera_M_contig85298.19881.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=121bpback to top |