mRNA_M-pyrifera_M_contig85151.19845.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig85151.19845.1 vs. uniprot
Match: A0A2V3J670_9FLOR (Uncharacterized protein n=1 Tax=Gracilariopsis chorda TaxID=448386 RepID=A0A2V3J670_9FLOR) HSP 1 Score: 60.1 bits (144), Expect = 2.050e-8 Identity = 38/118 (32.20%), Postives = 62/118 (52.54%), Query Frame = 1 Query: 4 FLDLNNMFIKTYADVVLESPLVAVCREQVAAGRAPAVLVDVVVLRRPFLELVWKQVQRGWFNARSNTNQRGVWYYSLGDVAEPSFRVLPPLVTLPATASSIAEELHLIVGYNLDIEER 357 + + ++MF+KT+ADVVLE +A C + + +V LRRP + +W Q++ GWF+A + + VWYY + DV V V+ +S + L +GYN D+ +R Sbjct: 43 YAETSHMFVKTFADVVLER--LADCAK-----------ISIVFLRRPARDTIWSQLRLGWFSA--GHSGKNVWYYDINDV-----HVNERQVSYSTNSSDAVDSL---IGYNADVLQR 137 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig85151.19845.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig85151.19845.1 >prot_M-pyrifera_M_contig85151.19845.1 ID=prot_M-pyrifera_M_contig85151.19845.1|Name=mRNA_M-pyrifera_M_contig85151.19845.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=112bp MFIKTYADVVLESPLVAVCREQVAAGRAPAVLVDVVVLRRPFLELVWKQVback to top mRNA from alignment at M-pyrifera_M_contig85151:489..845- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig85151.19845.1 ID=mRNA_M-pyrifera_M_contig85151.19845.1|Name=mRNA_M-pyrifera_M_contig85151.19845.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=357bp|location=Sequence derived from alignment at M-pyrifera_M_contig85151:489..845- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig85151:489..845- >mRNA_M-pyrifera_M_contig85151.19845.1 ID=mRNA_M-pyrifera_M_contig85151.19845.1|Name=mRNA_M-pyrifera_M_contig85151.19845.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=672bp|location=Sequence derived from alignment at M-pyrifera_M_contig85151:489..845- (Macrocystis pyrifera P11B4 male)back to top |