prot_M-pyrifera_M_contig85039.19822.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig85039.19822.1 vs. uniprot
Match: A0A540VB62_9CHLR (Uncharacterized protein n=1 Tax=Litorilinea aerophila TaxID=1204385 RepID=A0A540VB62_9CHLR) HSP 1 Score: 58.9 bits (141), Expect = 1.270e-6 Identity = 31/48 (64.58%), Postives = 37/48 (77.08%), Query Frame = 0 Query: 165 GLYAQANKFGQHCQASGRFAADGDAQTSQYVLRRQTTDGTANVELFLN 212 G++A A+ +G+ ASGRFAA+GDAQTS YVLR QTT GT ELFLN Sbjct: 642 GVFANASHYGEMAYASGRFAANGDAQTSVYVLR-QTTSGTTPEELFLN 688
BLAST of mRNA_M-pyrifera_M_contig85039.19822.1 vs. uniprot
Match: A0A2D5YZI2_9PLAN (Uncharacterized protein n=1 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2D5YZI2_9PLAN) HSP 1 Score: 56.2 bits (134), Expect = 8.510e-6 Identity = 29/45 (64.44%), Postives = 34/45 (75.56%), Query Frame = 0 Query: 165 GLYAQANKFGQHCQASGRFAADGDAQTSQYVLRRQTTDGTANVEL 209 G A A FGQ +A+G+F+A GDAQ S YVLRR+TTD TANVEL Sbjct: 259 GQEAVAEVFGQMARAAGKFSAVGDAQISTYVLRRRTTDATANVEL 303 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig85039.19822.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig85039.19822.1 ID=prot_M-pyrifera_M_contig85039.19822.1|Name=mRNA_M-pyrifera_M_contig85039.19822.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=212bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|