mRNA_M-pyrifera_M_contig85039.19822.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig85039.19822.1 vs. uniprot
Match: A0A540VB62_9CHLR (Uncharacterized protein n=1 Tax=Litorilinea aerophila TaxID=1204385 RepID=A0A540VB62_9CHLR) HSP 1 Score: 58.9 bits (141), Expect = 1.270e-6 Identity = 31/48 (64.58%), Postives = 37/48 (77.08%), Query Frame = 1 Query: 493 GLYAQANKFGQHCQASGRFAADGDAQTSQYVLRRQTTDGTANVELFLN 636 G++A A+ +G+ ASGRFAA+GDAQTS YVLR QTT GT ELFLN Sbjct: 642 GVFANASHYGEMAYASGRFAANGDAQTSVYVLR-QTTSGTTPEELFLN 688
BLAST of mRNA_M-pyrifera_M_contig85039.19822.1 vs. uniprot
Match: A0A2D5YZI2_9PLAN (Uncharacterized protein n=1 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2D5YZI2_9PLAN) HSP 1 Score: 56.2 bits (134), Expect = 8.510e-6 Identity = 29/45 (64.44%), Postives = 34/45 (75.56%), Query Frame = 1 Query: 493 GLYAQANKFGQHCQASGRFAADGDAQTSQYVLRRQTTDGTANVEL 627 G A A FGQ +A+G+F+A GDAQ S YVLRR+TTD TANVEL Sbjct: 259 GQEAVAEVFGQMARAAGKFSAVGDAQISTYVLRRRTTDATANVEL 303 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig85039.19822.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig85039.19822.1 >prot_M-pyrifera_M_contig85039.19822.1 ID=prot_M-pyrifera_M_contig85039.19822.1|Name=mRNA_M-pyrifera_M_contig85039.19822.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=212bp SVIGGGGLNIIADSRFSVIAGGRKNSVEADRNISAITGGEGNVIKTAGTHback to top mRNA from alignment at M-pyrifera_M_contig85039:3..728- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig85039.19822.1 ID=mRNA_M-pyrifera_M_contig85039.19822.1|Name=mRNA_M-pyrifera_M_contig85039.19822.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=726bp|location=Sequence derived from alignment at M-pyrifera_M_contig85039:3..728- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig85039:3..728- >mRNA_M-pyrifera_M_contig85039.19822.1 ID=mRNA_M-pyrifera_M_contig85039.19822.1|Name=mRNA_M-pyrifera_M_contig85039.19822.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=1272bp|location=Sequence derived from alignment at M-pyrifera_M_contig85039:3..728- (Macrocystis pyrifera P11B4 male)back to top |