prot_M-pyrifera_M_contig85006.19812.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig85006.19812.1 vs. uniprot
Match: D7FJE6_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FJE6_ECTSI) HSP 1 Score: 79.3 bits (194), Expect = 1.730e-15 Identity = 38/57 (66.67%), Postives = 48/57 (84.21%), Query Frame = 0 Query: 1 MTLEEYDEMKQQRKPSDRNPDVSLETRLKISARLKEKWKDPTYRERRKGCMPNRQGI 57 MTLEEY+EMK+++ R+P V+ ETR KISARLK KW+DP+YRERRK CMPNR+G+ Sbjct: 89 MTLEEYEEMKRRKPAGKRDPTVTEETRKKISARLKAKWQDPSYRERRKQCMPNRKGV 145
BLAST of mRNA_M-pyrifera_M_contig85006.19812.1 vs. uniprot
Match: A0A836CNQ5_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CNQ5_9STRA) HSP 1 Score: 54.3 bits (129), Expect = 1.300e-6 Identity = 31/63 (49.21%), Postives = 40/63 (63.49%), Query Frame = 0 Query: 1 MTLEEYDEMKQQRKPSDRNPD---VSLETRLKISARLKEKWKDPTYRERRKGCMPNRQGIAHS 60 MT+EEYD K++ D +S ET+ KISARLKEKWKDP +R+ R +P R+G HS Sbjct: 194 MTVEEYDASKRRTPKRDTKGGQVKLSEETKAKISARLKEKWKDPAFRKERLANIPTRKGRGHS 256 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig85006.19812.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig85006.19812.1 ID=prot_M-pyrifera_M_contig85006.19812.1|Name=mRNA_M-pyrifera_M_contig85006.19812.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=84bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|