mRNA_M-pyrifera_M_contig84421.19685.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig84421.19685.1 vs. uniprot
Match: A0A8J9S112_9CHLO (Probable EKC/KEOPS complex subunit LAGE3 n=1 Tax=Coccomyxa sp. Obi TaxID=2315456 RepID=A0A8J9S112_9CHLO) HSP 1 Score: 56.6 bits (135), Expect = 2.850e-8 Identity = 26/67 (38.81%), Postives = 44/67 (65.67%), Query Frame = 1 Query: 46 SEEHADIMKESLEAEGDLRPHLSHTKFSVEGSTLHVSVAAANPRALRANISSFYDMAGVTARTLAEF 246 SE A +++++L + +LRP L + +V+G+TLH+ +A + R LRA + +FYD+ G+ RTL F Sbjct: 54 SEADAQVVRDALAVDPELRPKLVTRELTVDGNTLHIFFSAVDTRTLRAAVGTFYDLLGLATRTLEAF 120 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig84421.19685.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig84421.19685.1 >prot_M-pyrifera_M_contig84421.19685.1 ID=prot_M-pyrifera_M_contig84421.19685.1|Name=mRNA_M-pyrifera_M_contig84421.19685.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=86bp LFPSDFYSNITVRMLSEEHADIMKESLEAEGDLRPHLSHTKFSVEGSTLHback to top mRNA from alignment at M-pyrifera_M_contig84421:365..622+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig84421.19685.1 ID=mRNA_M-pyrifera_M_contig84421.19685.1|Name=mRNA_M-pyrifera_M_contig84421.19685.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=258bp|location=Sequence derived from alignment at M-pyrifera_M_contig84421:365..622+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig84421:365..622+ >mRNA_M-pyrifera_M_contig84421.19685.1 ID=mRNA_M-pyrifera_M_contig84421.19685.1|Name=mRNA_M-pyrifera_M_contig84421.19685.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=516bp|location=Sequence derived from alignment at M-pyrifera_M_contig84421:365..622+ (Macrocystis pyrifera P11B4 male)back to top |