prot_M-pyrifera_M_contig84421.19685.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig84421.19685.1 vs. uniprot
Match: A0A8J9S112_9CHLO (Probable EKC/KEOPS complex subunit LAGE3 n=1 Tax=Coccomyxa sp. Obi TaxID=2315456 RepID=A0A8J9S112_9CHLO) HSP 1 Score: 56.6 bits (135), Expect = 2.850e-8 Identity = 26/67 (38.81%), Postives = 44/67 (65.67%), Query Frame = 0 Query: 16 SEEHADIMKESLEAEGDLRPHLSHTKFSVEGSTLHVSVAAANPRALRANISSFYDMAGVTARTLAEF 82 SE A +++++L + +LRP L + +V+G+TLH+ +A + R LRA + +FYD+ G+ RTL F Sbjct: 54 SEADAQVVRDALAVDPELRPKLVTRELTVDGNTLHIFFSAVDTRTLRAAVGTFYDLLGLATRTLEAF 120 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig84421.19685.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig84421.19685.1 ID=prot_M-pyrifera_M_contig84421.19685.1|Name=mRNA_M-pyrifera_M_contig84421.19685.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=86bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|