prot_M-pyrifera_M_contig84061.19612.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig84061.19612.1 vs. uniprot
Match: A0A2E2BZM2_9PLAN (Uncharacterized protein n=1 Tax=Gimesia sp. TaxID=2024833 RepID=A0A2E2BZM2_9PLAN) HSP 1 Score: 83.2 bits (204), Expect = 1.860e-16 Identity = 45/106 (42.45%), Postives = 67/106 (63.21%), Query Frame = 0 Query: 1 VADDRTQRERNDAIIEAFNANGGRAVWHPIAASPEDR-TEVMVWKHVGTVPRESRLTPLFQLRGLSKLLVYNFYTRDSDLAGIDQMEDLPGLLIRGQITDEGLRHL 105 + + + R RND + A+N +GG A WH + +E+MV + T R S PLFQ+RG+SK++++ D++L GI +M+DLP LLI G+ITD+GLRHL Sbjct: 20 IVEAQEHRVRNDEYLAAYNDSGGWAYWHDSKRGQDPHGSELMVRRSNRTELRVST-KPLFQMRGVSKVILHGVDFTDAELDGISEMKDLPSLLINGKITDDGLRHL 124 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig84061.19612.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig84061.19612.1 ID=prot_M-pyrifera_M_contig84061.19612.1|Name=mRNA_M-pyrifera_M_contig84061.19612.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=186bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|