mRNA_M-pyrifera_M_contig84061.19612.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig84061.19612.1 vs. uniprot
Match: A0A2E2BZM2_9PLAN (Uncharacterized protein n=1 Tax=Gimesia sp. TaxID=2024833 RepID=A0A2E2BZM2_9PLAN) HSP 1 Score: 83.2 bits (204), Expect = 1.860e-16 Identity = 45/106 (42.45%), Postives = 67/106 (63.21%), Query Frame = 1 Query: 1 VADDRTQRERNDAIIEAFNANGGRAVWHPIAASPEDR-TEVMVWKHVGTVPRESRLTPLFQLRGLSKLLVYNFYTRDSDLAGIDQMEDLPGLLIRGQITDEGLRHL 315 + + + R RND + A+N +GG A WH + +E+MV + T R S PLFQ+RG+SK++++ D++L GI +M+DLP LLI G+ITD+GLRHL Sbjct: 20 IVEAQEHRVRNDEYLAAYNDSGGWAYWHDSKRGQDPHGSELMVRRSNRTELRVST-KPLFQMRGVSKVILHGVDFTDAELDGISEMKDLPSLLINGKITDDGLRHL 124 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig84061.19612.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig84061.19612.1 >prot_M-pyrifera_M_contig84061.19612.1 ID=prot_M-pyrifera_M_contig84061.19612.1|Name=mRNA_M-pyrifera_M_contig84061.19612.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=186bp VADDRTQRERNDAIIEAFNANGGRAVWHPIAASPEDRTEVMVWKHVGTVPback to top mRNA from alignment at M-pyrifera_M_contig84061:153..710+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig84061.19612.1 ID=mRNA_M-pyrifera_M_contig84061.19612.1|Name=mRNA_M-pyrifera_M_contig84061.19612.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=558bp|location=Sequence derived from alignment at M-pyrifera_M_contig84061:153..710+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig84061:153..710+ >mRNA_M-pyrifera_M_contig84061.19612.1 ID=mRNA_M-pyrifera_M_contig84061.19612.1|Name=mRNA_M-pyrifera_M_contig84061.19612.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=1116bp|location=Sequence derived from alignment at M-pyrifera_M_contig84061:153..710+ (Macrocystis pyrifera P11B4 male)back to top |