prot_M-pyrifera_M_contig84036.19605.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig84036.19605.1 vs. uniprot
Match: D8LGJ5_ECTSI (Hypothetical leucine rich repeat protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LGJ5_ECTSI) HSP 1 Score: 103 bits (257), Expect = 4.210e-24 Identity = 47/52 (90.38%), Postives = 48/52 (92.31%), Query Frame = 0 Query: 1 MPALRHLDVSHNALCRMEPLDGRDLPPRLETLNMSHNRISRIGGIGHCFALR 52 MPALRHLDVSHN LCRMEP+DGRDLPPRLETLNMSHNRISRIGGI CF LR Sbjct: 1107 MPALRHLDVSHNLLCRMEPMDGRDLPPRLETLNMSHNRISRIGGIAQCFLLR 1158
BLAST of mRNA_M-pyrifera_M_contig84036.19605.1 vs. uniprot
Match: A0A6H5JAS8_9PHAE (EF-hand domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JAS8_9PHAE) HSP 1 Score: 102 bits (255), Expect = 7.830e-24 Identity = 47/52 (90.38%), Postives = 48/52 (92.31%), Query Frame = 0 Query: 1 MPALRHLDVSHNALCRMEPLDGRDLPPRLETLNMSHNRISRIGGIGHCFALR 52 MPALRHLDVSHN LCRMEP+DGRDLPPRLETLNMSHNRISRIGGI CF LR Sbjct: 1257 MPALRHLDVSHNLLCRMEPMDGRDLPPRLETLNMSHNRISRIGGITQCFLLR 1308
BLAST of mRNA_M-pyrifera_M_contig84036.19605.1 vs. uniprot
Match: A0A836CC45_9STRA (Uncharacterized protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CC45_9STRA) HSP 1 Score: 73.2 bits (178), Expect = 1.540e-14 Identity = 38/67 (56.72%), Postives = 47/67 (70.15%), Query Frame = 0 Query: 1 MPALRHLDVSHNALCRMEPLDGRD----LPPRLETLNMSHNRISRIGG-IGHCFALRVVNLRHNRIK 62 +PALRHLD SHN L R+EP+ LP LETL++SHNRI+RIGG + C LRVV L HNR++ Sbjct: 27 LPALRHLDASHNLLTRVEPVGSGGAAARLPRGLETLDLSHNRIARIGGGVAGCARLRVVRLAHNRLR 93 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig84036.19605.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig84036.19605.1 ID=prot_M-pyrifera_M_contig84036.19605.1|Name=mRNA_M-pyrifera_M_contig84036.19605.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=74bpback to top |