mRNA_M-pyrifera_M_contig84036.19605.1 (mRNA) Macrocystis pyrifera P11B4 male
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig84036.19605.1 vs. uniprot
Match: D8LGJ5_ECTSI (Hypothetical leucine rich repeat protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LGJ5_ECTSI) HSP 1 Score: 110 bits (274), Expect = 2.520e-26 Identity = 51/56 (91.07%), Postives = 52/56 (92.86%), Query Frame = 1 Query: 1 VLTTMPALRHLDVSHNALCRMEPLDGRDLPPRLETLNMSHNRISRIGGIGHCFALR 168 VLTTMPALRHLDVSHN LCRMEP+DGRDLPPRLETLNMSHNRISRIGGI CF LR Sbjct: 1103 VLTTMPALRHLDVSHNLLCRMEPMDGRDLPPRLETLNMSHNRISRIGGIAQCFLLR 1158
BLAST of mRNA_M-pyrifera_M_contig84036.19605.1 vs. uniprot
Match: A0A6H5JAS8_9PHAE (EF-hand domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JAS8_9PHAE) HSP 1 Score: 109 bits (272), Expect = 4.680e-26 Identity = 51/56 (91.07%), Postives = 52/56 (92.86%), Query Frame = 1 Query: 1 VLTTMPALRHLDVSHNALCRMEPLDGRDLPPRLETLNMSHNRISRIGGIGHCFALR 168 VLTTMPALRHLDVSHN LCRMEP+DGRDLPPRLETLNMSHNRISRIGGI CF LR Sbjct: 1253 VLTTMPALRHLDVSHNLLCRMEPMDGRDLPPRLETLNMSHNRISRIGGITQCFLLR 1308
BLAST of mRNA_M-pyrifera_M_contig84036.19605.1 vs. uniprot
Match: A0A836CC45_9STRA (Uncharacterized protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CC45_9STRA) HSP 1 Score: 73.9 bits (180), Expect = 9.040e-15 Identity = 39/70 (55.71%), Postives = 48/70 (68.57%), Query Frame = 1 Query: 4 LTTMPALRHLDVSHNALCRMEPLDGRD----LPPRLETLNMSHNRISRIGG-IGHCFALRVVNLRHNRIK 198 L +PALRHLD SHN L R+EP+ LP LETL++SHNRI+RIGG + C LRVV L HNR++ Sbjct: 24 LAELPALRHLDASHNLLTRVEPVGSGGAAARLPRGLETLDLSHNRIARIGGGVAGCARLRVVRLAHNRLR 93 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig84036.19605.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig84036.19605.1 >prot_M-pyrifera_M_contig84036.19605.1 ID=prot_M-pyrifera_M_contig84036.19605.1|Name=mRNA_M-pyrifera_M_contig84036.19605.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=74bp MPALRHLDVSHNALCRMEPLDGRDLPPRLETLNMSHNRISRIGGIGHCFAback to top mRNA from alignment at M-pyrifera_M_contig84036:161..394+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig84036.19605.1 ID=mRNA_M-pyrifera_M_contig84036.19605.1|Name=mRNA_M-pyrifera_M_contig84036.19605.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=234bp|location=Sequence derived from alignment at M-pyrifera_M_contig84036:161..394+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig84036:161..394+ >mRNA_M-pyrifera_M_contig84036.19605.1 ID=mRNA_M-pyrifera_M_contig84036.19605.1|Name=mRNA_M-pyrifera_M_contig84036.19605.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=444bp|location=Sequence derived from alignment at M-pyrifera_M_contig84036:161..394+ (Macrocystis pyrifera P11B4 male)back to top |