prot_M-pyrifera_M_contig82739.19335.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig82739.19335.1 vs. uniprot
Match: UPI0006D1FD12 (IS5/IS1182 family transposase n=2 Tax=Nocardia arizonensis TaxID=1141647 RepID=UPI0006D1FD12) HSP 1 Score: 58.5 bits (140), Expect = 8.500e-8 Identity = 36/101 (35.64%), Postives = 50/101 (49.50%), Query Frame = 0 Query: 6 FSHKHQTNGLKVQTAVCHRGVLNKYIFHYSQPIKAAQHD-KSFYEATTLPELRLPGEVYLGDKGYAGATGVCSPFKGRDLNPTQKQYNRQLSAIHVKVEHA 105 +S KH+ +G+ VQ G I S + + HD K+ + L EL G + LGDKGY GA GV +P+KGR QK NR + + + E A Sbjct: 121 YSGKHRRHGMNVQVIASPEGG----IVWVSPALPGSVHDSKAAWIWRVLHELEQQGWIVLGDKGYQGAQGVLTPYKGRGKPAAQKNANRAHAQLRGRGERA 217 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig82739.19335.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig82739.19335.1 ID=prot_M-pyrifera_M_contig82739.19335.1|Name=mRNA_M-pyrifera_M_contig82739.19335.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=117bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|