mRNA_M-pyrifera_M_contig81982.19179.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig81982.19179.1 vs. uniprot
Match: A0A4V1IUL3_9FUNG (RING-type domain-containing protein n=1 Tax=Caulochytrium protostelioides TaxID=1555241 RepID=A0A4V1IUL3_9FUNG) HSP 1 Score: 59.3 bits (142), Expect = 3.640e-8 Identity = 24/42 (57.14%), Postives = 30/42 (71.43%), Query Frame = 1 Query: 10 CAICLHTPERPTFTQPCFHGPFCFKHIDRWIGVSRSCPMCKR 135 CAICL +PE PTF PC+H FC+ IDRW V+ CP+CK+ Sbjct: 97 CAICLASPEDPTFLSPCYHA-FCWACIDRWSRVAAVCPLCKQ 137 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig81982.19179.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig81982.19179.1 >prot_M-pyrifera_M_contig81982.19179.1 ID=prot_M-pyrifera_M_contig81982.19179.1|Name=mRNA_M-pyrifera_M_contig81982.19179.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=99bp ETVCAICLHTPERPTFTQPCFHGPFCFKHIDRWIGVSRSCPMCKREIHAVback to top mRNA from alignment at M-pyrifera_M_contig81982:102..398- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig81982.19179.1 ID=mRNA_M-pyrifera_M_contig81982.19179.1|Name=mRNA_M-pyrifera_M_contig81982.19179.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=297bp|location=Sequence derived from alignment at M-pyrifera_M_contig81982:102..398- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig81982:102..398- >mRNA_M-pyrifera_M_contig81982.19179.1 ID=mRNA_M-pyrifera_M_contig81982.19179.1|Name=mRNA_M-pyrifera_M_contig81982.19179.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=594bp|location=Sequence derived from alignment at M-pyrifera_M_contig81982:102..398- (Macrocystis pyrifera P11B4 male)back to top |