mRNA_M-pyrifera_M_contig81712.19132.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig81712.19132.1 vs. uniprot
Match: A0A182JSG3_9DIPT (Uncharacterized protein n=1 Tax=Anopheles christyi TaxID=43041 RepID=A0A182JSG3_9DIPT) HSP 1 Score: 54.3 bits (129), Expect = 9.840e-5 Identity = 35/92 (38.04%), Postives = 53/92 (57.61%), Query Frame = 1 Query: 448 LLSAISSGDADGVAKLIEAGSNVNSRNGTNDAALPYLAQQYPSRRLSQQAAEKIFKLLLTSGADVNATDADGRTALHYAVRHKELELASWLV 723 +LS + + D + +LI+ G N+N R+ +L +A + S + + + I +LLL GADVNA D DG TALHYA +L+LA L+ Sbjct: 769 MLSYMEESNLDVIERLIQKGVNLNVRDRWGRNSLLAIAFGFRSAQWYGHSLKSI-ELLLDHGADVNAQDDDGNTALHYAFEEMQLDLAELLM 859 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig81712.19132.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig81712.19132.1 >prot_M-pyrifera_M_contig81712.19132.1 ID=prot_M-pyrifera_M_contig81712.19132.1|Name=mRNA_M-pyrifera_M_contig81712.19132.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=258bp QRKGKLNLRNNKGDTALHRALTRKNRLHYVRTLVDNGAAIDIANNNGFTPback to top mRNA from alignment at M-pyrifera_M_contig81712:91..864- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig81712.19132.1 ID=mRNA_M-pyrifera_M_contig81712.19132.1|Name=mRNA_M-pyrifera_M_contig81712.19132.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=774bp|location=Sequence derived from alignment at M-pyrifera_M_contig81712:91..864- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig81712:91..864- >mRNA_M-pyrifera_M_contig81712.19132.1 ID=mRNA_M-pyrifera_M_contig81712.19132.1|Name=mRNA_M-pyrifera_M_contig81712.19132.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=1548bp|location=Sequence derived from alignment at M-pyrifera_M_contig81712:91..864- (Macrocystis pyrifera P11B4 male)back to top |